KEGG   Macaca mulatta (rhesus monkey): 714090Help
Entry
714090            CDS       T01028                                 

Gene name
TPI1, TIM, tpi
Definition
(RefSeq) triosephosphate isomerase 1
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00010  Glycolysis / Gluconeogenesis
mcc00051  Fructose and mannose metabolism
mcc00562  Inositol phosphate metabolism
mcc01100  Metabolic pathways
mcc01200  Carbon metabolism
mcc01230  Biosynthesis of amino acids
Module
mcc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mcc_M00002  Glycolysis, core module involving three-carbon compounds
mcc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    714090 (TPI1)
   00051 Fructose and mannose metabolism
    714090 (TPI1)
   00562 Inositol phosphate metabolism
    714090 (TPI1)
Enzymes [BR:mcc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     714090 (TPI1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   714090 (TPI1)
  Exosomal proteins of bladder cancer cells
   714090 (TPI1)
  Exosomal proteins of melanoma cells
   714090 (TPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 714090
NCBI-ProteinID: XP_015006420
UniProt: H9ZD06
Position
11
AA seq 286 aa AA seqDB search
MAEDGEEAEFHFAALYISGQWPRLRADTDLQRLGSIAMAPSRKFFVGGNWKMNGRKQNLG
ELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGM
IKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKV
VFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSEAVAQ
STRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggacggcgaggaggcggagttccacttcgcggcgctctatataagcgggcag
tggccgcggctgcgcgcagacactgaccttcagcgtctcggctccatcgccatggcgcct
tccaggaagttcttcgttggggggaactggaagatgaacgggcggaagcagaatctgggg
gagctcatcggcactctgaacgcggccaaggtgccggcagacaccgaagtggtttgtgct
ccccccactgcctatatcgacttcgcccggcagaagctagatcccaagattgctgtggct
gcacagaactgctacaaagtgactaatggggcctttactggggagatcagccctggcatg
atcaaagactgcggagccacgtgggtggtcctggggcactcagagagaagacatgtcttt
ggggagtcagatgagctgattgggcagaaagtggcccatgctctggctgagggactcgga
gtaatcgcctgtattggggagaagctagatgaaagggaagctggcatcactgagaaggtt
gttttcgagcagacaaaggtcatcgcagataatgtgaaagactggagcaaggttgtcctg
gcctatgagcctgtgtgggccattggtactggcaagactgcaacgccccaacaggcccag
gaagtacatgagaagctccgaggatggcttaagtccaacgtctctgaagcagtggctcag
agcacccgtatcatttatggaggctctgtgactggggcaacctgcaaggagctggccagc
cagcctgacgtggatggcttccttgtgggtggtgcttccctcaagcccgaattcgtggac
atcatcaatgccaaacaatga

DBGET integrated database retrieval system