KEGG   Macaca mulatta (rhesus monkey): 714408
Entry
714408            CDS       T01028                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mcc03021]
    714408 (AFF3)
Transcription machinery [BR:mcc03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     714408 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 714408
NCBI-ProteinID: XP_028688069
Ensembl: ENSMMUG00000022836
Position
13
AA seq 1250 aa
MDSFDLALLQEWDLESLWGEDILNQRNDSLVVEFQSSASRCRSVYEPDRNALRRKERERR
NQETQQDDGTFNSSYSLFSEPYKTNKGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGV
PKPGVPQTPVNKIDEHFVADSRAQTQPSSIGSTTTSTPAAVPVQQTKRGTMGWQKAGHPP
SDGQQRATQQGSLRTLLGDGVGRQQPRAKQVCNVEVGLQTQERPPAMAAKHSSSGHCVQN
FPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKSPSETSVHCTSYRGVPASKPEPA
RAKAKLSKFSIPKQVEESRSGETNSCVEEIIREMTWLPPLSAIQAPGKVEPTKFPFPNKD
SQLVSSGHNNPKKGDAEPESPDNGTSNTSMLEDDLKLSSDEEENEQAAQRTALRTLSDST
VVQQPNCRTSVPSSKGSSSSSSSGSSSSSSDSESSSGSDSETESSSSESEGSKPPHFSSP
EAEPASSNKWQLDKWLNKVNPHKPPILIQNESHGPESNQYYNPVKEDVQDCGKVPDVCQP
SLREKEVKSTCKEEQRPRTANKAPGSKGVKQKSPPAAVAVAVSAAAPPPAVPCAPAENAP
APARRSAGKKPTRRAERTSAGDGANLHRPEEPAAPDALGASVVVPPEPTKTRPCGNNRAS
HRKELRSSVTCEKRRTRGLSRIVPKSKEFIETESSSSSSSSDSDLESEQEEYPLSKAQTV
AASASSGNDQRLKEAAANGGNGPRAPVGSINARTTSDIAKELEEQFYTLVPFGRNELLSP
LKDSDEVRSLWVKIDLTLLSRIPEHLPQEPGVLSAPATKDSESALPSHTSDTPAEKALPK
SKRKRKCDNEDDYREIKKAQGEKDSSSRLATSTGNTLSANHCNMNINSVAIPINKNEKML
RSPISPLSDASKHKYTSEDLTSSSRPNGNSLFTSASSSKKPKADSQLQPHGGDLTKAAHN
NSENIPLHKSRPQTEPWSPGSNGHRDCKRQKLIFDDMPRSADYFMQEAKRMKHKADAMVE
KFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSGPNATPE
DKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAAQAPSPWGASGKSTGT
PSPMSPNPSPASSVGSQGSLSNASALSPSTIVSIPQRIHQMAANHVSITNSILHSYDYWE
MADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGLHWLRNSAHLS
NT seq 3753 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttagccctgctccaggaatgggacctcgagtcgctgtggggtgaa
gacatcttaaaccagaggaatgactctctagttgtggaatttcagtcatcagccagcaga
tgcaggagtgtctatgagccagatagaaatgcattacggaggaaagaacgagaaagaaga
aatcaagaaactcaacaggatgacggcacgtttaattctagttactctctcttcagtgag
ccctacaagactaacaagggggatgaactgtccaaccggatccagaacactttaggcaat
tatgatgaaatgaaagactttttaactgatagatccaatcagagtcatctcgtcggagtt
cccaaacctggggttcctcagactcctgtgaacaagatcgatgaacattttgttgcagat
tcaagagcccagacccagccctcatctatcggtagcactacaacttccacaccagcagct
gtccccgtgcagcagactaagagaggcactatgggctggcagaaggctgggcacccaccc
tccgacggccaacagagagcaacacaacagggctctctcaggaccttgcttggagatggt
gttggcagacagcagccacgggccaaacaagtatgcaatgtggaggtgggccttcagacc
caggagagaccacctgccatggcggccaagcacagcagcagcggacactgtgttcagaac
tttcctccatccctagcttcaaaacccagcctggtccagcagaaaccgaccgcgtacgtg
cggccgatggacggccaagatcaggcccctgatgagtctcctaagctgaagtcgccttcg
gaaaccagcgtgcactgcacatcgtacagaggagtccccgccagcaagccggagccggcc
agagccaaggccaagctctccaagttcagcatccccaagcaggtggaggagagtagatct
ggagaaaccaacagctgtgttgaagaaataatccgggagatgacctggcttccaccactt
tctgctattcaagcacctggcaaagtggaaccaaccaaatttccatttccaaataaggac
tctcagcttgtatcctctggacacaataatccaaagaaaggtgatgcagagccagagagt
ccagacaatggcacatcgaatacatcaatgctggaagatgaccttaagctaagcagtgat
gaagaggagaatgaacaggcagctcagagaacggctctccgcactctgtctgacagcacc
gtggtccagcagcccaactgcagaacctcagtgccttccagcaagggcagcagcagcagc
agcagcagcggcagcagcagctcctccagcgactcagagagcagctcaggatctgactcg
gagaccgagagcagctccagcgagagtgagggcagcaagcccccccacttctccagccct
gaggctgaaccggcatcctctaacaagtggcagctggataaatggctgaacaaagttaat
ccccacaagcctcctattctgatccaaaacgaaagccacgggccagagagcaatcagtac
tacaacccggtgaaagaggacgtccaggactgtgggaaagtccccgacgtctgccagccc
agcctgagggagaaggaggtcaagagcacctgcaaggaggagcagaggccgaggacagcc
aacaaggcccctgggagtaaaggcgtgaagcagaagtccccgcccgcggccgtggccgtg
gctgtgagcgcagccgccccgccgcccgcagtgccctgtgcgcccgcggagaacgcacct
gcgcctgcccggaggtcggcgggcaagaagcccaccaggcgcgcggagaggacctcagcc
ggggacggcgccaacctccaccggcccgaggagcccgcggccccggacgcactgggcgca
agcgtggtggtccccccggagcccaccaaaaccaggccctgtggcaacaacagagcgagc
caccgcaaggagctgcgctcctccgtgacctgcgagaagcgccgcacgcgggggctgagc
aggatcgtccccaaatccaaggagttcattgagacagagtcgtcatcgtcgtcctcctcc
tcggactccgacctggagtccgagcaggaggagtaccctctgtccaaagcacagaccgtg
gctgcctctgcctcctccgggaatgatcagaggctgaaggaggccgctgccaatgggggc
aatggtcccagggcccctgtaggctccatcaacgccaggaccaccagtgacatcgccaag
gagctggaggagcagttctacaccctggtcccctttggccggaacgaacttctgtcccct
ctaaaggacagtgatgaggtcaggtctctctgggtcaaaattgacctgaccctcctgtcc
aggatcccagagcacctgccgcaggaaccaggggtcttgagcgcccctgccaccaaggac
tctgagagcgcactgcccagccacacctcagacacacctgcagaaaaggctttgccaaaa
tccaagaggaaacgcaagtgtgacaacgaagacgactacagggagatcaagaaggcccag
ggagagaaagacagctcttcaagactggccacctccaccggtaatactttgtctgcaaac
cactgcaacatgaacatcaacagtgtggcaataccaataaataaaaatgaaaaaatgctt
cggtcgcccatctcacccctctccgatgcatctaaacacaaatacaccagcgaggactta
acttcttccagccgacctaatggcaacagtttgttcacttcagcctcttccagcaaaaag
cctaaggccgacagccagctgcagcctcacggcggagacctcacgaaagcagctcacaac
aattctgaaaacattcccctccacaagtcacgaccgcagacggagccgtggtctccaggc
tccaacggccacagggactgcaagaggcagaaactcatcttcgatgatatgcctcgcagt
gccgattattttatgcaagaagctaaacgaatgaagcataaagcagatgcaatggtggaa
aagtttggaaaggctttgaactatgctgaagcggcgttgtcgtttattgagtgtggaaat
gcaatggaacaaggccccatggaatccaaatctccttatacgatgtattcagaaacagta
gagctcatcaggtatgccatgagactaaaaacccactcaggccccaacgccacaccagaa
gacaaacaactggctgcattatgttaccgatgcctggctctcctgtactggcggatgttt
cgactcaaaagggaccacgctgtaaagtattcaaaagcactaattgactatttcaagaac
tcatctaaagccgcccaagccccatccccgtggggggccagtggaaagagcactggaacc
ccatcccccatgtctcccaacccctctcccgccagctcagtggggtctcagggcagcctc
tccaacgccagcgccctgtccccgtcgaccatcgtcagcatcccacagcgcatccaccag
atggcggccaaccacgtcagcatcaccaacagcatcctgcacagctacgactactgggag
atggccgacaacctggccaaggaaaaccgagaattcttcaacgacctggatctgctcatg
gggccggtcaccctgcacagcagcatggagcacctggtccagtactcccaacagggcctg
cactggctgcggaacagcgcccacctgtcatag

DBGET integrated database retrieval system