KEGG   Macaca mulatta (rhesus monkey): 714621Help
Entry
714621            CDS       T01028                                 

Gene name
MTMR4
Definition
(RefSeq) myotubularin-related protein 4 isoform X1
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00562  Inositol phosphate metabolism
mcc01100  Metabolic pathways
mcc04070  Phosphatidylinositol signaling system
mcc04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    714621 (MTMR4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    714621 (MTMR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    714621 (MTMR4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    714621 (MTMR4)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     714621 (MTMR4)
    3.1.3.64  phosphatidylinositol-3-phosphatase
     714621 (MTMR4)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     714621 (MTMR4)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    714621 (MTMR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE Y_phosphatase DSPc Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 714621
NCBI-ProteinID: XP_014974629
Ensembl: ENSMMUG00000046171
Position
16
AA seq 1195 aa AA seqDB search
MGEEGPPSLEYIQAKDLFPPKELVKEEENLQVPFTVLQGEGVEFLGRAADALIAISNYRL
HIKFKDSVINVPLRMIDSVESRDMFQLHISCKDSKVVRCHFSTFKQCQEWLSRLSRATAR
PAKPEDLFAFAYHAWCLGLTEEDQHTHLCQPGEHIRCRQEAELARMGFDLQNVWRVSHIN
SNYKLCPSYPQKLLVPVWITDKELENVASFRSWKRIPVVVYRHLRNGAAIARCSQPEISW
WGWRNADDEYLVTSIAKACALDPGTRATGGSLSTGNNDTSEACDADFDSSLTACSGVEST
AAPQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEVVFMGMANIHAIRNSFQYLRAVC
SQMPDPSNWLSALESTKWLQHLSVMLKAAVLVANTVDREGRPVLVHCSDGWDRTPQIVAL
AKILLDPYYRTLEGFQVLVESDWLDFGHKFGDRCGHQENVEDQNEQCPVFLQWLDSVHQL
LKQFPCLFEFNEAFLVKLVQHTYSCLYGTFLANNPCEREKRNIYKRTCSVWALLRAGNKN
FHNFLYTPSSDMVLHPVCHVRALHLWTAVYLPASSPCTLGEENMDLYLSPVAQSQEFSGR
SLDRLPKTRSMDDLLSACDTSSPLTRTSSDPNLNNHCQEVRVGLEPWHSNPEGSETTFVD
SGVGGPQQTVGEVGLPPPLPSSQKDYLSNKPFKSHKNCSPSYKLLNTAVPREMKSNTSDP
EIKVLEETKGPAPNPSAQNEVGRTLDGTGEPPEHCPETEAVSALSKVISNKCDGVCNFPE
SSQDSSTGAPQQAQPDSLLGVPYKCVLDHSLSTLCNPPSAACQTPLGPRADFLNQDPSGS
VASISHQEQPSSVPDLTHGEEDIGKRGNNRNGQLLENPRFGKMPLELVRKPISQSQISEF
SFLGSNWDSFQGMVTSFPSGEATPRRLLSYGCCSKRPNSKQMRATGPCFGGQWAQREGMK
SPVCSSHSNGHCTGPGGKNRMWLSSHPKQVSSTKPVPLTCPSPVPPLYLDDDGLPFPTDV
IQHRLRQIEAGYKQEVEQLRRQVRELQMRLDIRHCCAPPAEPPMDYEDDFTCLKESDGSD
TEDFGSDHSEDCLSEASWEPVDKKETEVTRWVPDHMASHCYNCDCEFWLAKRRHHCRNCG
NVFCAGCCHLKLPIPDQQLYDPVLVCNSCYEHIQVSRARELMSQQLKKPIATASS
NT seq 3588 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaggaggggccccccagcctggagtacatccaagccaaggatctgttccccccc
aaggaactagtgaaggaggaggagaatcttcaggtccccttcacagtgctgcagggtgag
ggagtagagttcctgggccgggcagccgatgccctcattgccatctctaactaccggctg
catatcaaattcaaggactctgtcatcaacgtccccctccggatgattgacagtgtggag
agccgtgatatgttccagttgcacatttcctgcaaggactccaaagtggtgaggtgtcac
ttctccactttcaagcagtgccaagagtggctctcacggctaagccgagccacagcaaga
cctgccaagcctgaggacctctttgcctttgcctaccatgcctggtgcctggggctgact
gaggaggaccagcacactcacctatgtcagccaggtgagcacatacgttgtcggcaggag
gcggagcttgcaaggatgggctttgacctgcagaacgtctggagagtctcacacatcaac
agcaactacaaattgtgccccagttacccccagaagctgctggttcctgtgtggatcact
gacaaagagctggagaatgtggcttccttccgctcctggaagcggatccccgtggttgtg
tatagacacttgcgcaatggggctgccattgcccgctgcagccagccagagatcagctgg
tggggctggcgcaatgctgatgatgagtatctggtcacgtccatcgctaaagcctgtgcc
ctggacccggggacaagggccactgggggctccctcagcaccgggaataatgataccagc
gaggcgtgtgatgcagactttgattcctctctgactgcatgctctggagtggagagcaca
gcagccccccagaagctgctgatcctggatgcgcgatcctacacagcagcagtggccaac
cgggccaagggtggaggctgtgaatgcgaagagtactatcccaactgtgaggtcgtgttc
atgggaatggccaacatccatgccatccggaacagctttcagtacctccgggctgtgtgt
agccagatgccggatcctagcaactggttgtcggcattggagagtaccaaatggctgcag
cacttgtcggtaatgctaaaagcagctgtgctggtggcaaatacagtagaccgggaaggc
cggcctgtgctggtacactgctccgacggctgggaccgcacaccacagatcgtagccctg
gccaaaatattactggacccatattacaggacgttggagggcttccaagtgttagtggag
tctgactggctggattttgggcacaagtttggagatcgctgtggccaccaagagaatgtg
gaggaccaaaacgaacaatgccctgtgttcctccagtggcttgattctgttcatcagttg
cttaagcagttcccctgcctgtttgaatttaatgaagcattcctggtaaaactggtgcaa
cacacatactcctgcctctatggcacattcctggccaacaacccctgtgagcgagagaag
cgcaacatctacaagcggacctgctctgtgtgggcgctccttcgagctggcaataaaaac
tttcataacttcctctacacacccagctcagacatggtcctgcatcctgtttgtcatgtc
cgggccctgcacctctggacggctgtttatctgccagcatcatctccatgcacacttggg
gaggaaaacatggatctttacctttccccagtggcccagagccaggagttctctggccgc
tctctggacagattacctaaaaccagatccatggatgatcttctttctgcctgtgacaca
agcagccccctgactcgtacatccagtgaccctaacctgaataaccactgtcaggaggtc
agggtaggcctggagccctggcacagcaatcctgagggatcagagacaacctttgtggac
tctggggtaggaggtcctcagcagactgtgggagaagtgggtcttcctcctcctctgccc
agcagccagaaagactacttgagcaataaacctttcaagagtcacaaaaactgttctcca
agttacaaattgcttaataccgcagtgcctcgggaaatgaagagcaacacctctgatcct
gagatcaaagtcctggaagagactaagggaccagctcccaacccttctgcccagaatgag
gtgggtaggactttagatggcacaggggagccacctgaacattgtcctgaaacagaagct
gtcagtgcactctccaaggtcatttctaataagtgtgatggagtttgtaattttcctgag
tcttcccaggactcttctacaggtgcgccccaacaggcccagccagactccttgctaggt
gtgccctacaaatgtgttctcgatcacagcctcagcaccctttgcaacccaccaagtgct
gcctgccaaactcctctaggcccaagggctgacttcctcaaccaagatccctcagggtct
gtggcaagtatctcccaccaggagcaaccgagttctgtgccagatctgactcatggggag
gaagacattggtaaaagaggaaataataggaatgggcagttattggaaaatcctcgcttt
gggaaaatgccattggaattggtccggaagccaatttctcagagccagattagtgagttc
tcttttctagggtccaactgggacagcttccaagggatggtgacttcattcccaagtggg
gaggccacccctcggcggctgctttcctatggctgttgtagcaagaggccaaacagtaag
cagatgcgggccacggggccctgctttgggggccagtgggctcagagagaaggtatgaag
tcacctgtctgttctagtcattccaatggacattgtactggcccaggaggaaagaaccgg
atgtggttgtccagtcacccaaagcaagtctctagcacaaagcctgttccactgacctgt
ccttctccagtgcctcctctctatttggatgatgatggactcccctttcccacggatgtg
atccagcataggttacggcaaatcgaagcagggtacaagcaagaggtagagcagctacgt
cgacaggtgcgtgagcttcagatgaggctggatatccgtcactgctgtgcccctccagca
gagcctcccatggactatgaggatgattttacatgtttgaaggagtcagatggcagcgat
actgaggattttggctctgatcacagtgaagactgcctttcagaagcaagctgggaacct
gttgataagaaagagactgaggtgactcgctgggttccagaccatatggcatcacactgc
tataactgtgactgtgaattctggttggccaaacgaagacaccattgcagaaattgtggg
aatgtattttgtgctggatgctgccacctgaagctgcccattcctgatcagcaactctat
gacccagttctcgtctgtaactcctgttacgaacacattcaagtctctcgtgccagggaa
ctcatgagccaacagctgaagaaacccattgctacagcttccagttga

DBGET integrated database retrieval system