KEGG   Macaca mulatta (rhesus monkey): 714684
Entry
714684            CDS       T01028                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00230  Purine metabolism
mcc01100  Metabolic pathways
mcc01522  Endocrine resistance
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04114  Oocyte meiosis
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04714  Thermogenesis
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04727  GABAergic synapse
mcc04742  Taste transduction
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04921  Oxytocin signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc04976  Bile secretion
mcc05032  Morphine addiction
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05200  Pathways in cancer
mcc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    714684 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    714684 (ADCY4)
   04371 Apelin signaling pathway
    714684 (ADCY4)
   04020 Calcium signaling pathway
    714684 (ADCY4)
   04072 Phospholipase D signaling pathway
    714684 (ADCY4)
   04024 cAMP signaling pathway
    714684 (ADCY4)
   04022 cGMP-PKG signaling pathway
    714684 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    714684 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    714684 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    714684 (ADCY4)
   04062 Chemokine signaling pathway
    714684 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    714684 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    714684 (ADCY4)
   04912 GnRH signaling pathway
    714684 (ADCY4)
   04913 Ovarian steroidogenesis
    714684 (ADCY4)
   04915 Estrogen signaling pathway
    714684 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    714684 (ADCY4)
   04921 Oxytocin signaling pathway
    714684 (ADCY4)
   04926 Relaxin signaling pathway
    714684 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    714684 (ADCY4)
   04918 Thyroid hormone synthesis
    714684 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    714684 (ADCY4)
   04916 Melanogenesis
    714684 (ADCY4)
   04925 Aldosterone synthesis and secretion
    714684 (ADCY4)
   04927 Cortisol synthesis and secretion
    714684 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    714684 (ADCY4)
   04270 Vascular smooth muscle contraction
    714684 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    714684 (ADCY4)
   04971 Gastric acid secretion
    714684 (ADCY4)
   04972 Pancreatic secretion
    714684 (ADCY4)
   04976 Bile secretion
    714684 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    714684 (ADCY4)
   04727 GABAergic synapse
    714684 (ADCY4)
   04725 Cholinergic synapse
    714684 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    714684 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    714684 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    714684 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    714684 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    714684 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    714684 (ADCY4)
   04714 Thermogenesis
    714684 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    714684 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    714684 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    714684 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    714684 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    714684 (ADCY4)
   05163 Human cytomegalovirus infection
    714684 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    714684 (ADCY4)
Enzymes [BR:mcc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     714684 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N DUF3180 CD52
Other DBs
NCBI-GeneID: 714684
NCBI-ProteinID: XP_028707286
Ensembl: ENSMMUG00000020698
Position
7
AA seq 1077 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLVVAWASGRELTSDPS
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWVALLALGHAFLFTGGVVSAWDQV
SYFLFVIFTVYAMLPLGMRDAAVAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVAGVYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSLLMTR
YLESWGAAKPFAHLSHVDSPVSTSTPLQEKTLASFSPQWSLDRSRTLRGLDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFI
IQMLVTNRPPALAITYSITFLLFLLLLFVCFSEDLMRCVLKGPKMLHWLPALSGLVATRP
GLRIALGTATILLVFAMAITSLFFFPASSDCPFQAPNVSSMISNLSWELPGSLPLISVPY
SMHCCTLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSDCLIVRLYLGPLDS
RPGVLKEPKFMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMV
EFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETAWALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRSGPPSVTLG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagcccccggccaccccccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccgctgctgctgctgctgctgggaatcgtgctctgtgcg
ctcgcggcgctgctcgtggttgcctgggccagcggcagggagctgacctcagacccgagc
ttcctgaccactgtgctgtgcgcgctgggcggcttctcgctgctgctgggcctcgcttcc
cgcgagcagcgactgcagcgctggacgcgtcctctgtccggcttggtatgggtcgcgctg
ctagcgctaggccacgccttcctgttcaccgggggcgtggtgagcgcctgggaccaggtg
tcctattttctcttcgtcatcttcacggtgtatgccatgctgcccttgggcatgcgggac
gccgccgtcgcgggcctcgcctcctcactctcgcatctactggtcctggggctgtatctt
gggccacagccggactcacggcctgcactgctgcctcagttggcagcaaatgcggtgctg
ttcctgtgcgggaacgtggcaggagtgtaccacaaggcgctgatggagcgcgccctgcgg
gccacgttccgggaggcactcagctccttgcactcgcgccggcggctggacaccgaaaag
aagcaccaggaacaccttctcttgtccatccttcctgcctacctggcccgagagatgaaa
gcagagatcatggcacggctgcaggcaggacaggggtcacggccagagagcaccaacaat
ttccacagcctctatgtcaagaggcaccagggagtcagtgtgctgtatgctgacattgtg
ggcttcacgcggctggccagcgagtgttcccctaaggagctggtgctcatgctcaatgag
ctctttggcaagttcgaccagatcgccaaggagcatgaatgcatgcggatcaagatcctg
ggggactgttactactgtgtctccggactgccactctcactgccagaccatgccatcaac
tgcgtgcgcatggggctggacatgtgccgggccatcaggaaactgcgggcagccactggc
gtggacatcaacatgcgtgtgggcgtgcactcaggcagtgtactctgtggagtcatcggg
ctgcagaagtggcagtatgacgtttggtcccatgatgtcacactggctaaccacatggag
gcaggcggtgtaccagggcgagtgcacatcacaggggctaccctggccctgctggcagga
gcttatgctgtggaggacgcaggcatggagcatcgggatccctaccttcgggagctaggg
gagcccacctatctggtcatcgatccacgggcagaggaggaggatgagaagggcactgca
ggaggcttgctctcctcgcttgagggccccaagatgcgtccatcactgctgatgacccgt
tacctggagtcctggggtgcagccaagccttttgcccacctgagccacgtagacagccct
gtgtccacctccacccctctccaggagaagaccctggcttccttcagcccccagtggagc
ctagatcggagccgtaccctccgtggactggatgatgaactggacaccggggatgccaag
ttcttccaggtcattgagcagctcaactcacagaaacagtggaagcagtcgaaggacttc
aacccactgacactgtacttcagagagaaggagatggagaaagagtaccgactctctgca
atccccgccttcaaatactatgaagcctgcaccttcctggtttttctctccaacttcatc
atccagatgctagtgacaaacaggcccccagctctggccatcacgtatagcatcaccttc
ctcctcttcctcctcctcctttttgtctgcttctcagaggacctgatgaggtgtgtcctg
aaaggccccaagatgctgcactggctgcctgcactgtctggcctggtggccacacgacca
ggactgagaatagccttgggcaccgccaccatcctccttgtctttgccatggccattacc
agcctgttcttcttcccagcatcatcagactgccctttccaagctcccaatgtgtcctcc
atgatttccaacctctcctgggagctccctgggtctctgcctctcatcagtgtcccatac
tccatgcactgctgcacgctgggcttcctctcctgctccctctttctgcacatgagcttc
gagctgaagctgctgctgctcctgctgtggctggcagcatcctgctccctcttcctgcac
tcccacgcctggctgtccgactgcctcatcgtccgcctctatctgggccccttggactcc
aggcccggagtgctgaaggagcccaaattcatgggtgctatctccttcttcatcttcttc
ttcaccctccttgtcctggctcgccagaatgagtactactgccgcctggacttcctgtgg
aagaagaagctgaggcaggagcgggaggagacagagacgatggagaacctgactcggctg
ctcttggagaacgtgctccctgcacacgtggccccccagttcattggccagaaccggcgc
aacgaggatctctaccaccagtcctacgaatgcgtttgtgtcctcttcgcttcagtccca
gacttcaaggagttctactctgaatccaacatcaatcatgagggcctagagtgtctgagg
ctgctcaatgaaataattgctgattttgatgagctgctctccaagcccaagttcagtggg
gtggagaagatcaagaccattggcagcacctacatggcagccacaggattaaatgccacc
tctggacaggatgcacaacaggatgctgaacggagctgcagccaccttggcactatggtg
gaatttgccgttgccctggggtctaagctggacgtcatcaacaagcattcattcaacaac
ttccgcctgcgtgtggggttgaaccacggaccagtagtagctggagttattggggcccag
aagccacaatatgacatttggggcaacacagtgaatgtggccagccgcatggagagtaca
ggagtccttggcaaaatccaagtgactgaggagacagcctgggccctacagtccctgggc
tacacctgctacagccggggggtcatcaaggtgaaaggcaaagggcagctctgcacctac
ttcctgaacacagacttgacacgaagtggacctccttcagttaccctaggctga

DBGET integrated database retrieval system