KEGG   Macaca mulatta (rhesus monkey): 714962
Entry
714962            CDS       T01028                                 
Symbol
HSDL1
Name
(RefSeq) inactive hydroxysteroid dehydrogenase-like protein 1
Organism
mcc  Macaca mulatta (rhesus monkey)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Polysacc_synt_2 NAD_binding_10 Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 714962
NCBI-ProteinID: NP_001181480
Ensembl: ENSMMUG00000045253
UniProt: G7NPE7 A0A8J8YCC1
Position
20:complement(71135778..71158514)
AA seq 330 aa
MAAVDSFYLLYREIARSCNCYMEALALVGAWYTARKSITVICDFYSLIRLHFIPRLGSRA
DLIKQYGRWAVVSGATDGIGKAYAEELASRGLNIILISRNEEKLQVVAKDIADTYKVETD
IIVADFSSGREIYLPIQEALKDRDIGILVNNVGVFYPYPQYFTQLSEDKLWDIINVNIAA
ASLMVHVVLPGMVERKKGAIVTISSGSCCKPTPQLAAFSASKAYLDHFSRALQYEYASKG
IFVQSLIPFYVATSMTAPSSFLHRCSWLVPSPKVYAHHAVSTLGISKRTTGYWSHSIQFL
FAQYMPEWLWVWGANILNRSLRKEALSCTA
NT seq 993 nt   +upstreamnt  +downstreamnt
atggctgctgttgacagcttctacctcttgtacagggaaatcgccaggtcttgcaattgc
tatatggaagctctagctttggttggagcctggtatacggccagaaaaagcatcactgtc
atctgtgacttttacagcctgatcaggctgcattttatcccccgcctggggagcagagca
gacttgatcaagcagtatggaagatgggccgttgtcagtggtgcaacagatgggattgga
aaagcctacgctgaggagttagcaagccgaggtctcaatatcatcctgattagtcggaat
gaggagaagttgcaggttgttgctaaagacatagccgacacgtacaaagtggaaactgat
attatagttgcggacttcagcagcggccgtgagatctaccttccaattcaagaagccctg
aaggacagagacattggcatcttggtaaataacgtgggtgtgttttatccctacccgcag
tatttcactcagctctctgaggacaagctctgggacatcataaatgtgaacatagccgcc
gctagtttgatggtccatgtcgtgttacccggaatggtggagagaaagaaaggtgccatc
gtcacgatctcttctggctcctgctgcaaacccactcctcagctggctgcattttctgct
tctaaggcttatttagaccacttcagcagagccttgcagtatgaatatgcctctaaagga
atctttgtacagagtctaatccctttctacgtagccaccagcatgacagcacccagcagc
tttctgcacaggtgctcgtggttggtgccttcgccaaaagtctatgcacatcatgctgtt
tctactctcggaatttccaaaaggaccacagggtactggtcccattctattcagtttctt
tttgcacagtatatgcctgaatggctctgggtgtggggagcaaatattctcaaccgttca
ctacgtaaggaggccttgtcctgcacagcctga

DBGET integrated database retrieval system