KEGG   Macaca mulatta (rhesus monkey): 715474Help
Entry
715474            CDS       T01028                                 

Gene name
GPX7
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00480  Glutathione metabolism
mcc00590  Arachidonic acid metabolism
mcc04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    715474 (GPX7)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    715474 (GPX7)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    715474 (GPX7)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     715474 (GPX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA SCO1-SenC
Motif
Other DBs
NCBI-GeneID: 715474
NCBI-ProteinID: NP_001152840
Ensembl: ENSMMUG00000019676
UniProt: F7CH76
Position
1
AA seq 184 aa AA seqDB search
MVAAAAWLLLWAVACAQREQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQH
YRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGT
GAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILRK
REDL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggcggcggcgtggctgctcctgtgggctgtggcctgcgcgcagcgggagcag
gacttctacgacttcaaggcggtcaacatccggggcaaactggtgtcgctggagaagtac
cgcggctcggtatccctggtggtgaatgtggccagcgagtgcggcttcacagaccagcac
taccgagccctgcagcagctgcagcgggacctgggtccccaccacttcaacgtactcgcc
ttcccctgcaaccagtttggccaacaggagcctgacagcaacaaggagattgagagcttt
gcccgccgcacctacagtgtctcattccccatgtttagcaagattgcagtcaccggtact
ggtgcccatcctgccttcaagtacctggcccagacttctgggaaggagcccacctggaac
ttctggaagtaccttgtagccccagatggaaaggtggtaggggcttgggacccaactgtg
tcagtggaggaggtcagaccccagatcacagcgctcgtgaggaagctcatcctacggaag
cgagaagacttataa

DBGET integrated database retrieval system