KEGG   Macaca mulatta (rhesus monkey): 715513
Entry
715513            CDS       T01028                                 
Symbol
DCXR
Name
(RefSeq) L-xylulose reductase isoform X1
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00040  Pentose and glucuronate interconversions
mcc01100  Metabolic pathways
Module
mcc_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    715513 (DCXR)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     715513 (DCXR)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase ADH_zinc_N Shikimate_DH NAD_binding_10 RmlD_sub_bind DUF3742 DUF1776 THF_DHG_CYH_C NAD_binding_7 2-Hacid_dh_C AdoHcyase_NAD
Other DBs
NCBI-GeneID: 715513
NCBI-ProteinID: XP_001112983
Position
16:complement(78344219..78346885)
AA seq 244 aa
MELGLAGRRVLVTGAGKGIGRGTVQVLHAAGARVVAVSRTQADLDSLVRECPGIEPVCVD
LGDWEATERALGSVGPVDLLVNNAAVALLQPFLEVTKDAFDRSFEVNLRAVIQVSQIVAR
GLIARGAPGAIVNISSQCSQRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPT
VVMTHMGQATWSDPCKAKTMLDRIPLGKFAEVEHVVDAILFLLSDRSGMTTGSTLPVEGG
FWAN
NT seq 735 nt   +upstreamnt  +downstreamnt
atggagttgggtctcgcgggccgccgggtgctggtcaccggggcgggcaaaggtatcggg
cgcggcacggtccaggtgctgcacgcggcgggcgcgcgggtggtggctgtgagccgaaca
caggcggatcttgacagcctcgtccgcgagtgcccggggatagagcccgtgtgcgtggac
ctgggtgactgggaggccaccgagcgggcgctgggcagcgtgggccccgtggacctgctg
gtgaacaacgccgctgtcgccctgctgcagcccttcctggaggtcaccaaggatgccttt
gacagatcctttgaagtgaacctgcgtgcggtcatccaggtgtcacagatcgtggccagg
ggcttaatagcccggggagccccgggggccatcgtgaatatctccagccagtgctcccag
cgggcagtaactaaccatagcgtctactgctccaccaagggtgccctggacatgctgacc
aaggtgatggccctagagctcgggccccacaagatccgagtgaatgcagtaaaccccaca
gtggtgatgacgcacatgggccaggccacctggagtgacccctgcaaggccaagactatg
ctggaccgaatcccacttggcaagtttgctgaggtagagcatgtggtggatgccatcctc
tttctgctgagtgaccgaagcggcatgaccacgggctccactctgccggtggaagggggc
ttctgggccaactga

DBGET integrated database retrieval system