KEGG   Macaca mulatta (rhesus monkey): 715924Help
Entry
715924            CDS       T01028                                 

Gene name
PLCD3
Definition
(RefSeq) phospholipase C delta 3
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00562  Inositol phosphate metabolism
mcc01100  Metabolic pathways
mcc04020  Calcium signaling pathway
mcc04070  Phosphatidylinositol signaling system
mcc04919  Thyroid hormone signaling pathway
mcc04933  AGE-RAGE signaling pathway in diabetic complications
Module
mcc_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    715924 (PLCD3)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    715924 (PLCD3)
   04070 Phosphatidylinositol signaling system
    715924 (PLCD3)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    715924 (PLCD3)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    715924 (PLCD3)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     715924 (PLCD3)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    715924 (PLCD3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    715924 (PLCD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_10 EF-hand_like C2 EF-hand_7 S_100 PH TEP1_N YqzL SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 715924
NCBI-ProteinID: XP_001115230
Position
16
AA seq 785 aa AA seqDB search
MLCGRWRRCRRPPEEPPVAAQVAAPVALPSPPTPSDGGTKRPGLRALKKMGLTEDEDVRA
MLLGSRLRKIRSRTWHKERLYRLQEDGLSVWFQRRIPRAPSQHIFFVQHIEAVREGHQSE
GLRRFGGAFAPARCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLTKLRARLDAMSQRERLD
HWIHSYLHRADSNQDSKMSFKEIKSLLRMVNVDMNDMYAYLLFKECDHSNNDRLEGAEIE
EFLRRLLKRPELEEIFHQYSGEDRVLSAPELLEFLEDQGEEGATLARAQQLIQTYELNET
AKQHELMTLDGFMMYLLSPEGAALDTTHTCVFQDMNQPLAHYFISSSHNTYLTDSQIGGP
SSTEAYIRAFAQGCRCVELDCWEGPGGEPIIYHGHTLTSKILFRDVVQAVRDHAFTLSPY
PVILSLENHCGLEQQAAMARHLRTILGDMLVTQALDSPNPEELPSPEQLKGRVLVKGKKL
PAARSEDGRALSDREEEEDDDEEEEEEAETAAQRRLAKQISPELSALVVYCHATRLRTLH
PAPDAPQPCQVSSLSERKAKKLIREAGNSFVRHNARQLTRVYPLGLRMNSANYSPQEMWN
SGCQLVALNFQTPGYEMDLNAGRFLVNGQCGYVLKPACLRQPDSTFDPEDPGPPRTTLSI
QVLTAQQLPKLNAEKPHSIVDPLVRVEIHGVPADCARQETDYVLNNGFNPHWGQTLQFQL
RAPELALVRFVVEDYDATSPNDFVGQFTLPLSSLKQGYRHIHLLSKDGASLSPATLFIQI
RIQHP
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcggccgctggaggcgctgccgccgcccgcccgaggagcccccggtagccgcc
caagtcgcggcgccggtcgcgctcccgtccccgccgactccctccgatggcggcaccaag
aggcccgggctgcgggcgctgaagaagatgggcctgacggaggacgaggacgtgcgcgcc
atgctgctgggctcccggctccgcaagatccgctcgcgcacgtggcacaaggagcggctg
taccggctgcaggaggacggcctgagcgtgtggttccagcggcgcatcccgcgcgcgccg
tcgcagcacatcttctttgtgcagcacatcgaggcagtccgcgagggccaccagtccgag
ggcctgcggcgcttcgggggtgccttcgccccggcgcgctgcctcaccatcgccttcaag
ggccgccgcaagaacctggacctggcggcgcccacggctgaggaagcgcagcgctgggtg
cgcggtctgaccaagctccgcgcgcgcctggacgccatgagccagcgcgagcggctggac
cactggatccactcgtatctgcaccgggctgactccaaccaggacagcaagatgagcttc
aaggagatcaagagcctgctgagaatggtcaacgtggacatgaacgacatgtacgcctac
ctcctcttcaaggagtgtgaccactccaacaatgaccgtctagagggggctgagattgag
gagttcctgcggcggctgctgaagcggccggagctggaggagatcttccatcagtactcg
ggcgaggaccgcgtgctgagtgcccctgagctgctggagttcctggaggaccagggcgag
gagggcgccacgctggcccgcgcccagcagctcattcagacctacgagctcaacgagaca
gccaagcagcacgagctgatgacactggatggcttcatgatgtacctgttgtcgccggag
ggggctgccttggacaccacccacacgtgtgtgttccaggacatgaaccagcccctcgcc
cactacttcatctcttcctcccacaacacctatctgaccgactcccagattggggggccc
agcagcaccgaggcctacattagggcctttgcccagggatgccgctgtgtggagctggac
tgctgggaggggccaggaggggagcccatcatctatcacggacatactctcacctccaag
attctcttccgggatgtggtccaagccgtgcgtgaccatgccttcacgctgtccccctac
cctgtcatcctatccctggagaaccactgcgggctggagcagcaggctgccatggcccgc
cacctccgcaccatcctaggggacatgctggtgacacaggcgctggactccccaaatcct
gaggagctgccttccccagagcagctgaagggccgggtcctggtgaaggggaagaagctg
cctgctgctcggagcgaggatggccgggctctgtcggacagggaggaggaggaggacgat
gacgaggaggaagaagaggaggcggagactgcagcacagaggcggctggctaagcagatc
tccccggagctgtcggccctggtcgtgtactgccacgccacccgcctgcggaccctgcac
cctgcccccgacgccccgcagccctgccaggtcagctccctcagcgagcgcaaagccaag
aaactcatccgggaagcagggaacagcttcgtcaggcacaatgcccgccagctgacccgc
gtgtacccgctggggctgcggatgaactcggccaactatagtccccaggagatgtggaac
tcgggctgtcagctggtggccttgaacttccagacgccaggctacgagatggacctcaat
gccggccgcttcctggtcaatgggcagtgtggctacgtcctgaaacctgcctgcctgcgg
caacctgactcgacctttgaccctgaggacccgggacctcccagaaccactctcagcatc
caggtgctgactgcacagcagctgcccaagctgaacgccgagaagccacattccattgtg
gaccccctggtgcgcgttgagatccatggggtgcccgcagactgtgcccggcaggagact
gactatgtgctcaacaatggcttcaacccccactgggggcagaccctgcagttccagctg
cgggctccggagctggcgctggtccggtttgtggtggaagattatgacgccacctccccc
aatgactttgtgggccagtttacactgcctcttagcagcctaaagcaagggtaccgccac
atacacctgctttccaaggacggggcctcactgtcaccagctacgctcttcattcaaatc
cgcatccagcacccctga

DBGET integrated database retrieval system