KEGG   Macaca mulatta (rhesus monkey): 715958
Entry
715958            CDS       T01028                                 

Gene name
SIPA1
Definition
(RefSeq) signal-induced proliferation-associated protein 1 isoform X1
  KO
K08013  signal-induced proliferation-associated gene 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    715958 (SIPA1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    715958 (SIPA1)
SSDB
Motif
Pfam: Rap_GAP PDZ PDZ_6 MscS_porin ATG16 Rab5-bind CENP-F_N ZapB PI3K_P85_iSH2 YabA LPP ERM
Other DBs
NCBI-GeneID: 715958
NCBI-ProteinID: XP_014969258
Ensembl: ENSMMUG00000007416
UniProt: H9ZCI7
Position
14
AA seq 1042 aa
MPMWAGGVGSPRRGMAPASTDDLFARKLRQPARPPLTPHTFDPRPVRGPLLRSGSDAGEA
RPPTPASPRARAHSHEEASRPAATSTRLFTDPLALLGLPAEEPEPAFPPVLEPRWFAHYD
VQSLLFDWAPRSQGTGSHSEASSGTLASADDQAASSDLLHGAPGFVCELGGEGELGLGGP
ASPPVPPALPNAAVSILEEPQNRTSAYSLEHADLGAGYYRKYFYGKEHQNFFGMDESLGP
VAVSLRREEKEGSGGGTLHSYRVIVRTTQLRTLRGTISEDALPPGPPRGLSPRKLLEHVA
PQLSPSCLRLGSASPKVPRTLLTLDEQVLSFQRKVGILYCRAGQGSEEEMYNNQEAGPAF
MQFLTLLGDVVRLKGFESYRAQLDTKTDSTGTHSLYTTYQDHEIMFHVSTMLPYTPNNQQ
QLLRKRHIGNDIVTIVFQEPGSKPFCPATIRSHFQHVFLVVRAHAPCTPHTSYRVAVSRT
QDTPAFGPALPAGGGPFAANADFRAFLLAKALNGEQAAGHARQFHAMATRTRQQYLQDLA
TNEVTTTSLDSASRFGLPSLGGRRRAAPRGPGTELQAAGSLVWGVRAASGARVAAGAQAS
GPEGAEVPCLLGISAEALVLVAPRDGRVVFNCACRDVLAWTFSEQQLDLYHGRGEAITLR
FDGSPGQAVGEVVARLQLVSRGCETRELALPRDGQGRLGFEVDAEGFVTHVERFTFAETA
GLRPGARLLRVCGQTLPSLRPEAAAQLLRSAPKVCVTVLPPDESGRPRRSFSELYMLSLQ
EPSRRGAPEPVQDEVQGVTLLPTTKQLLHLCLQDGGSPPVPGDLAEERTEFLHSQNSLSP
RSSLSDEAPVLPTTTPDLLLATTAKPSVPSADSEAPLTQDGPGSPSGSEDKGNPAPELRA
SFLPRTLSLRNSISRIMSEAGSGTLEDEWQAISEIASTCNTILESLSREGQPIPESGDPK
GTPKSDAEPEPGNLSEKVSHLESMLRKLQEDLQKEKADRAALEEEVRSLRHNNRRLQAES
ESAATRLLLASKQLGSPTADLA
NT seq 3129 nt   +upstreamnt  +downstreamnt
atgcccatgtgggctggcggtgtggggagccctcggcggggcatggcccctgcgtccacg
gatgacctctttgcccgcaagctgcgccagccagcacggcccccgctgacaccgcacacc
ttcgatccgaggccagtccggggcccgctcctgcgcagcggcagtgatgcaggcgaggcc
agaccccccacgccagccagcccccgtgcccgtgcccacagccacgaagaggccagccgc
cctgcagccacttccacccggctcttcactgacccgctggcactgctggggctgccagcc
gaggaaccagagcctgccttcccgccagtgcttgagcctcgatggtttgcccactatgac
gtgcaaagcctgctctttgattgggctccgaggtctcaggggacggggagccactcagag
gccagctctgggaccctggcttcagcggacgaccaggctgccagctcggacctgctgcat
ggggcacctggctttgtgtgtgagctcgggggtgagggtgagctaggcctgggtggacca
gcatccccacctgtgccccctgcactgcccaacgcggccgtgtccatcctggaggagcca
cagaaccgaacctcggcctacagcctggagcacgcagacctgggtgccggctactaccgc
aagtacttctatggcaaagaacatcagaacttcttcgggatggacgagtcgctcggcccg
gtggcagtgagcctgcggcgggaggagaaggagggcagcggagggggcaccctgcacagc
taccgcgtcatcgtgcggactacgcagctccggaccctccgtggcaccatctcggaggac
gcgttgccgccggggcccccacggggtctgtccccaaggaaacttctggagcacgtggcg
ccgcagctgagccccagctgcctgcgcctgggctcagcttcacccaaggtaccacggacg
ctgctcacactggatgagcaagtgctgagtttccagcgcaaggtgggcatcctgtactgc
cgggcgggccagggctcagaggaggagatgtacaacaaccaggaggcgggaccagccttc
atgcagtttctcaccttgctgggcgatgtggtgcggctcaaaggctttgagagttaccgg
gcccaactagacaccaaaacggattccacaggcacacactccctctacaccacgtaccag
gaccacgagatcatgttccacgtgtccacgatgctgccttacacccccaacaaccagcag
cagctcctgcggaagcgtcacattggcaacgacattgtgaccatcgtgttccaggagcct
ggcagcaagcccttctgccccgccaccatccgctcacacttccaacacgtgttcctagtg
gtgcgggcacacgcaccctgcacaccgcacacctcctacagggtggctgtgagccgtacc
caggacaccccggccttcgggccagctctgcctgctggcggaggccccttcgcggccaac
gccgacttccgcgccttcctgctggccaaggcgctgaatggcgagcaggcggccggccac
gcacgccagttccacgccatggccacacgcacccgccagcagtacctgcaagacctggcc
accaacgaagtgaccactacgtcgctggactcggcctcacgcttcggcttgccttcccta
ggggggaggcgccgggcagcccctcggggcccgggcaccgagctgcaggcagctggctca
ctggtgtggggcgtgcgcgctgcgtccggggcgcgggtcgccgccggggctcaggcgagc
ggccccgaaggcgccgaggtgccctgcctgctgggcatctcggccgaggctctggtgctg
gtggcgccgcgcgacggccgcgtagtgttcaattgcgcctgtcgcgacgtgctggcctgg
accttctccgagcagcagctggacctgtaccacggccgcggggaggcgatcacgctgcgc
ttcgacgggtcccccggccaagccgtgggcgaggtggtggcgcgcctgcagctggtgagc
cgcggctgcgagacccgcgagctggcgctgccccgcgacggtcaaggccgcctgggcttc
gaggtggacgccgagggcttcgtcacgcacgtggaacgcttcacgttcgccgagacggcg
gggctgcggcccggggcgcgcctgctgcgcgtgtgcggccagacgctgcccagcctccgg
cccgaggccgctgcccagctgctgcgctcggcgcccaaggtctgcgtcaccgtcctgccc
cccgacgagagcggccggccccgcaggagtttttcggagctgtacatgctgtctctgcag
gagcccagccggcggggggccccagagcctgtgcaggatgaggtccagggggtgaccctg
ctgcccaccacaaaacagctgctgcacctatgcctgcaagatggtggcagtcctccagtg
cctggggatctggccgaggagaggaccgagttcctgcacagccagaactcgttgtcacca
cgcagctccctgtcagatgaggccccagtcctgcccaccaccaccccggatctcctcctg
gccaccacggccaagccatcagtacccagtgctgacagtgaggcacccctgacccaggac
gggccaggcagtcccagtggctctgaggacaagggcaacccggctccagagctgagggcc
tcctttctgccacgtaccttgtctctgcggaactccatcagcaggatcatgtcggaggca
ggcagtgggaccctggaggatgagtggcaggccatctcggagatcgcctccacttgcaac
accattctggagtcactgtccagagagggacagcccatcccagagagcggagaccctaag
ggaactccaaagtctgatgctgagccagagcctgggaacctctcagagaaggtctctcac
ttggagtccatgctcaggaagctgcaggaggacctgcagaaggagaaggcggacagggca
gccctggaggaggaggtgcggagcctgagacacaacaaccgacggctgcaggcagagtct
gagagcgcagccacacgcctgctcctggcctccaagcagctgggctctcccaccgctgac
ctggcctga

DBGET integrated database retrieval system