KEGG   Macaca mulatta (rhesus monkey): 716055Help
Entry
716055            CDS       T01028                                 

Gene name
LTB4R
Definition
(RefSeq) leukotriene B4 receptor 1
  KO
K04296  leukotriene B4 receptor 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    716055 (LTB4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcc04030]
    716055 (LTB4R)
G protein-coupled receptors [BR:mcc04030]
 Rhodopsin family
  Lipid
   Leukotriene
    716055 (LTB4R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 716055
NCBI-ProteinID: XP_014998943
Ensembl: ENSMMUG00000020697
UniProt: F6PJG7
Position
7
AA seq 352 aa AA seqDB search
MNTTSPAASPSLGVGFIVLLAIILLSVALAVGLPGNSFVVWSILKRMKKRSVTALLVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMALRVLAGIWVVSFLLATPVLVYRTVVALKTNMSLCYPKYPSKEHEAF
HLIFEALTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILAFAAFWLPYHVV
NLAEAARALAGQASGSGLVGQRLKLARSVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTVRGGPAAQEPGPSESLTASSPLELNELN
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaacactacatctcctgcagcatccccctcactaggtgtagggttcatcgttctgttg
gctatcatcctgctgtcagtggcgctggctgtggggcttcccggcaacagctttgtggtg
tggagcatcttgaaaaggatgaagaagcgctctgtcactgccctgttggtgctgaacctg
gccctggccgacctggccgtattgctcactgctccctttttccttcacttcctggcccaa
ggcacctggagttttggattggctggttgtcgcctgtgccactatgtctgtggagtcagc
atgtacgccagtgtcctgcttatcacagccatgagtctagaccgctcactggcagtggcc
cgcccctttgtatcccagaagctacgcaccaaggcaatggccctgcgggtgctggcaggc
atctgggtggtgtcctttctgctggccacacccgtcctcgtgtaccgcacagtagtggcc
ttgaaaacgaacatgagcctgtgctatccgaagtaccccagcaaggagcacgaggccttc
catctaatcttcgaggccctcacgggcttcctgctgcccttcctggctgtggtggccagc
tactccgacatagggcgtcggctgcaggcccggcgcttccgccgcagccgccgcactggt
cgcctggtggtgctcatcatcctggccttcgccgccttctggctgccctaccacgtggtg
aacctggccgaggctgcccgtgcgctggccggccaggcctccgggtcggggctcgtgggg
cagcggctgaaactggcccgcagcgtactcatcgcgctcgccttcctgagcagcagcgtg
aaccccgtgctgtacgcgtgcgccggcggcggcctgctacgctcggcgggcgtgggcttc
gtcgccaagctgctggagggcacgggctccgaggcgtccagcacccgccgcgggggcagc
ctgggccagaccgtgaggggcggccccgccgctcaggagcccggtccttccgagagcctc
actgcttccagccctctggagttaaacgaactgaactag

DBGET integrated database retrieval system