KEGG   Macaca mulatta (rhesus monkey): 716056Help
Entry
716056            CDS       T01028                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01524  Platinum drug resistance
mcc04115  p53 signaling pathway
mcc04210  Apoptosis
mcc04215  Apoptosis - multiple species
mcc04932  Non-alcoholic fatty liver disease (NAFLD)
mcc05010  Alzheimer's disease
mcc05012  Parkinson's disease
mcc05014  Amyotrophic lateral sclerosis (ALS)
mcc05016  Huntington's disease
mcc05134  Legionellosis
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05167  Kaposi's sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex infection
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05222  Small cell lung cancer
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    716056
   04215 Apoptosis - multiple species
    716056
   04115 p53 signaling pathway
    716056
 Human Diseases
  Cancers
   05200 Pathways in cancer
    716056
   05210 Colorectal cancer
    716056
   05222 Small cell lung cancer
    716056
  Neurodegenerative diseases
   05010 Alzheimer's disease
    716056
   05012 Parkinson's disease
    716056
   05014 Amyotrophic lateral sclerosis (ALS)
    716056
   05016 Huntington's disease
    716056
  Cardiovascular diseases
   05416 Viral myocarditis
    716056
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    716056
  Infectious diseases
   05134 Legionellosis
    716056
   05152 Tuberculosis
    716056
   05164 Influenza A
    716056
   05161 Hepatitis B
    716056
   05168 Herpes simplex infection
    716056
   05163 Human cytomegalovirus infection
    716056
   05167 Kaposi's sarcoma-associated herpesvirus infection
    716056
   05145 Toxoplasmosis
    716056
  Drug resistance
   01524 Platinum drug resistance
    716056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrom_C550 Cytochrome_CBB3 DDE_Tnp_1
Motif
Other DBs
NCBI-GeneID: 716056
NCBI-ProteinID: XP_001106593
Ensembl: ENSMMUG00000031718
UniProt: F7BMG9
Position
1
AA seq 105 aa AA seqDB search
MGDVEKGKKIFVQKCAQCLTMEKGGKHKTGPNLHGLFGQKTGQAVGFSYTDANKNKRITW
GEDTLMEYLENPKKYIPGTKMIFAGIKNKVEKADLTAYLKKATNE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttgttcagaaatgtgcccagtgtctcacc
atggaaaagggaggcaagcacaagactgggcctaatctccatggtctctttgggcagaag
acaggtcaggccgttggattctcttacacagatgccaataagaacaaacgcatcacctgg
ggagaggatacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatctttgccggcattaaaaataaggtagaaaaggccgacttgacagcttatctcaaa
aaagctactaatgagtaa

DBGET integrated database retrieval system