KEGG   Macaca mulatta (rhesus monkey): 716633Help
Entry
716633            CDS       T01028                                 

Definition
(RefSeq) heat shock 70 kDa protein 1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03040  Spliceosome
mcc04010  MAPK signaling pathway
mcc04141  Protein processing in endoplasmic reticulum
mcc04144  Endocytosis
mcc04213  Longevity regulating pathway - multiple species
mcc04612  Antigen processing and presentation
mcc04915  Estrogen signaling pathway
mcc05134  Legionellosis
mcc05145  Toxoplasmosis
mcc05162  Measles
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    716633
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    716633
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    716633
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    716633
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    716633
  09152 Endocrine system
   04915 Estrogen signaling pathway
    716633
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    716633
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    716633
  09172 Infectious disease: viral
   05162 Measles
    716633
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    716633
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    716633
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mcc03041]
    716633
   03009 Ribosome biogenesis [BR:mcc03009]
    716633
   03110 Chaperones and folding catalysts [BR:mcc03110]
    716633
   04131 Membrane trafficking [BR:mcc04131]
    716633
   03051 Proteasome [BR:mcc03051]
    716633
   03029 Mitochondrial biogenesis [BR:mcc03029]
    716633
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    716633
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     716633
Spliceosome [BR:mcc03041]
 Complex B
  Other components
   Prp19 complex
    716633
 Complex C
   Prp19-CDC5 complex
    716633
Ribosome biogenesis [BR:mcc03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    716633
Chaperones and folding catalysts [BR:mcc03110]
 Heat shock proteins
  HSP70 / DNAK
   716633
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    716633
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    716633
Proteasome [BR:mcc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    716633
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    716633
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   716633
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Radial_spoke_3
Motif
Other DBs
NCBI-GeneID: 716633
NCBI-ProteinID: XP_001113356
Ensembl: ENSMMUG00000029822
UniProt: F7CZ86
Position
4
AA seq 641 aa AA seqDB search
MAAAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINEGGKPKVLVSYKGENKAFYPEE
ISSMVLTKMKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKGGRGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLV
SHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSIT
RARFEELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQRLLQDYFNGRD
LNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNS
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTF
DIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAA
KNALESYAFNMKSVVSDEGLKGKISESDKKKILDKCNELLSWLEANQLAEKDEFDHKRKE
LEQMCNPIITKLYQGGCTGPACGTGYAPGRPATGPTIEEVD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgccaagggaattgccataggtatcgacctgggcaccacctactcctgtgtg
ggggtgttccagcacggcaaggtggagatcatcgccaatgaccagggcaaccgcaccacc
cccagctacgtggccttcacagacaccgagcggctcattggggatgcggccaagaaccag
gtagccatgaatccccagaacactgtttttgatgccaaacgtctgatcggcaggaaattt
aatgatcctgttgtgcaatcagatatgaaactttggccttttcaagtgattaatgaagga
ggcaagcccaaagtgcttgtgtcctacaaaggggagaataaagctttctaccctgaggaa
atctcttcgatggtactgactaagatgaaagagactgctgaggcgtttttgggccaccct
gtcaccaatgcagtgattaccgtgccagcctatttcaatgactctcaacgtcaggctact
aaggatgcaggtgtgattgctggacttaatgtgctacgaatcatcaatgagcccacagct
gctgccattgcctatggtttagataaaggaggtcgaggagaacgacatgtcctgattttt
gatctgggtggaggcacatttgatgtgtcaattctgaccatagatgatgggatttttgag
gtaaaggccactgctggggacactcacctgggtggggaggactttgacaacaggcttgtg
agccacttcgtggaagagttcaagcggaagcacaagaaggacatcagccagaacaagcga
gccgtgaggcggctgcgcacagcctgcgagagggccaagaggaccctgtcgtccagcacc
caggccaacctagaaattgattcactttatgaaggcattgacttctacacatccatcacc
agagctcgatttgaagagttgtgtgcagacctttttaggggtaccctggagcctgtagaa
aaagcacttcgggatgccaagatggataaggctaaaatccatgacattgttttagtaggg
ggctccacccgcatccccaaggtgcagcggctgcttcaggactactttaatggacgtgat
ctcaacaagagcatcaaccctgatgaggcagtagcatatggggctgcggtacaggcggcc
atcctgatgggggacaagtctgagaaggtgcaggacctgctgctgctggacgtggctccc
ctgtcgctggggctggagacggccgggggtgtgatgactgccctgatcaagcgtaactcc
accatccccaccaagcagacacagatcttcaccacctactccgacaaccaacccggggtg
ctgatccaggtatacgaaggtgagagggccatgacgaaggacaacaacctgctagggcgc
tttgacctgactggaatccctccagcacccaggggagttcctcagatcgaggtgacgttt
gacattgatgccaatggtattctcaatgtcacagccatggacaagagcacagggaaggcc
aacaagatcaccatcaccaatgacaagggccgcctgagcaaggaggagattgagcgcatg
gttctggatgctgagaaatataaagctgaagatgaggtccagagggagaaaattgctgca
aagaatgccttagaatcctatgcttttaacatgaagagtgttgtgagtgatgaaggtttg
aagggcaagatcagtgagtctgataaaaagaaaatactggataaatgcaatgaacttctt
tcgtggctggaggccaatcaactggcagagaaagatgagtttgatcataagagaaaggaa
ttggagcagatgtgtaaccccatcatcacaaaactctaccagggaggatgcactgggcct
gcctgtggaacagggtatgcgcctggaaggcctgccacaggccccacaattgaagaagta
gattaa

DBGET integrated database retrieval system