KEGG   Macaca mulatta (rhesus monkey): 716802Help
Entry
716802            CDS       T01028                                 

Gene name
DNASE2
Definition
(RefSeq) deoxyribonuclease-2-alpha
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    716802 (DNASE2)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     716802 (DNASE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNase_II
Motif
Other DBs
NCBI-GeneID: 716802
NCBI-ProteinID: XP_014978525
Position
19
AA seq 404 aa AA seqDB search
MSPPGFPGKFREIKGARCQSWPLLQPIAPQPRHRFLDLSPIAAMIPLLLAALLCVPAGAL
TCYGDSGQPVDWFVVYKLPALRGSGEAAQRGLQYKYLDESSGGWRDGRGLIDSPEGAVGR
SLQPLYRSSNSSQLAFLLYNDQPPQASKAHNSSKRGHTKGVLLLDHDGGFWLVHSVPDFP
PLASSAAYRWPHSACTYGQTLLCVSFPFTQFSKIGKQLTYTYPQVYDYQLEGIFAQEFPD
LENVIQGYHVSQEPWNSSVTLTSQAGAVFQSFAKFSKFGDDLYSGWLAAALGTNLQVQFW
HKTVGVLPSNCSDIWQVLNVNQIAFPGPGGPSFNSTEDHSKWCVSPKGPWTCVGDMNRNQ
GEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGMARKPSRHYKI
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtccccgcccgggttcccaggcaagtttagggaaataaaaggtgccaggtgccagtcc
tggcctctgttgcaacccatcgccccgcagccccgacacagattcctggatctcagcccc
atagcagcgatgatcccgctgctgctggccgcgctgctgtgcgtccccgccggggccctg
acctgctacggggactctgggcagcctgtagactggttcgtggtctacaagctgccagct
cttagagggtccggggaggcggcgcagagagggctgcagtacaagtatctggacgagagc
tccggaggctggcgggacggcaggggactcatcgacagcccggagggggccgtgggccga
agcctacagccgctgtaccggagcagcaacagcagccagctcgccttcctgctctacaat
gaccaaccgcctcaagccagcaaggctcacaactcttccaaacgtgggcacacgaagggt
gtcctgctcctcgaccacgacggaggcttctggctggtccacagcgtacctgacttccct
ccactggcctcctctgctgcatacaggtggcctcatagcgcctgtacctacgggcagacc
ctgctctgtgtgtcttttcccttcactcagttctcgaagattggcaagcagctgacctac
acctacccccaggtttatgactaccagctggaagggatcttcgcccaggaattccccgac
ttggagaatgtgatccagggctaccacgttagccaagaaccctggaacagcagcgtcaca
ctcacatcccaggccggggctgttttccagagctttgccaagtttagcaaatttggagat
gacctgtactctggctggttggcggcagcccttggtaccaacctgcaggtccagttctgg
cacaaaactgtaggcgtcctgccctctaactgctcggatatctggcaggttctgaatgtg
aaccagatagctttccctggaccgggtggcccaagcttcaacagcacagaggaccactcc
aaatggtgcgtgtccccaaaagggccctggacgtgcgtgggtgacatgaatcggaaccag
ggagaggagcaacggggtgggggcacgctgtgtgcccagctgccagccctctggaaggcc
ttccagccgctggtgaagaactaccagccctgtaatggcatggccaggaagcccagcaga
cattataagatctaa

DBGET integrated database retrieval system