KEGG   Macaca mulatta (rhesus monkey): 718407Help
Entry
718407            CDS       T01028                                 

Definition
(RefSeq) eukaryotic translation initiation factor 1
  KO
K03113  translation initiation factor 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    718407
Translation factors [BR:mcc03012]
 Eukaryotic Type
  Initiation factors
   eIF-1
    718407
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SUI1 DUF2729
Motif
Other DBs
NCBI-GeneID: 718407
NCBI-ProteinID: XP_001116333
Ensembl: ENSMMUG00000019505
UniProt: F7D2W5
Position
4
AA seq 113 aa AA seqDB search
MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLV
KAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctatccagaacctccactctttcgacccctttgctgatgcaagtaagggtgat
gacctgcttcctgctggcactgaggattatatccatataagaattcaacagagaaacggc
aggaagacccttactactgtccaagggatcgctgatgattacgataaaaagaaactagtg
aaggcgtttaagaagaagtttgcctgcaatggtactgtaattgagcatccagaatatgga
gaagtaattcagctacagggtgaccaacgcaagaacatatgccagttcctcgtagagatt
ggactggctaaggacgatcagctgaaggttcatgggttttaa

DBGET integrated database retrieval system