KEGG   Macaca mulatta (rhesus monkey): 718456Help
Entry
718456            CDS       T01028                                 

Gene name
UXS1
Definition
(RefSeq) UDP-glucuronic acid decarboxylase 1 isoform X1
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00520  Amino sugar and nucleotide sugar metabolism
mcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    718456 (UXS1)
Enzymes [BR:mcc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     718456 (UXS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase UXS1_N NAD_binding_4 RmlD_sub_bind 3Beta_HSD Polysacc_synt_2
Motif
Other DBs
NCBI-GeneID: 718456
NCBI-ProteinID: XP_014968539
Ensembl: ENSMMUG00000001693
UniProt: H9ZDS8 F7G2Y6
Position
13
AA seq 425 aa AA seqDB search
MVSKALLRLVSAVNRRRMKLLLGIALLAYVASVWGNFVNMSFLLNRSIQENGELKIESKI
EEMVEPLREKIRDLEKSFTQKYPPVKFLSEKDRKRILVTGGAGFVGSHLTDKLMMDGHEV
TVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKT
LKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGK
RVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQ
TRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQ
DDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKG
RTRHN
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggtgagcaaggcgctgctgcgcctcgtgtctgccgtcaaccgcaggaggatgaagctg
ctgctgggcatcgccttgctggcctacgtcgcctctgtttggggcaacttcgttaatatg
agctttctactcaacaggtctatccaggaaaacggggaactaaaaatcgaaagcaagatt
gaagagatggttgaaccactaagagagaaaatcagagatttagaaaaaagctttacccag
aaatacccaccagtaaagtttttatcggaaaaggatcggaaaagaattttggtaaccgga
ggcgcagggttcgtgggctcccatctaactgacaaactcatgatggacggccacgaggtg
accgtggtggacaatttcttcacgggcaggaagagaaacgtggagcactggatcggacat
gagaacttcgagctgattaaccacgacgtggtagagcccctctacatcgaggttgaccag
atataccatctggcatctccagcctcccctccaaactacatgtataatcctatcaagaca
ttaaagaccaatacgattgggacattaaacatgttggggctggcaaaacgagtcggcgcc
cgtctgctcctggcctccacatcggaggtgtatggagatcctgaagtccaccctcaaagt
gaggattactggggccacgtgaatccaataggacctcgggcctgctatgatgaaggcaaa
cgtgtcgcagagaccatgtgctatgcctacatgaagcaggaaggcgtggaagtacgagtg
gccagaatcttcaacacctttggaccacgcatgcacatgaatgatgggcgggtggtcagc
aacttcatcctgcaggcgctccaaggggagccgctcacggtatacggatctgggtctcag
acaagggcgttccagtacgtcagtgatctggtgaatggcctcgtggctctcatgaacagc
aacgtcagcagcccagtcaacctggggaacccagaagaacacacaatcctagaatttgct
cagttaattaaaaaccttgttggtagcggaagtgaaattcagtttctctccgaagcccag
gatgacccacagaaaagaaaaccagacatcaaaaaagcgaagctgatgctggggtgggag
cccgtggtcccgctagaggaaggtttaaacaaagcaattcactacttccgtaaagaactc
gagtaccaggcaaataatcagtacatccccaaaccaaagcctgccagaataaagaaagga
cggactcgccacaactga

DBGET integrated database retrieval system