KEGG   Macaca mulatta (rhesus monkey): 718632Help
Entry
718632            CDS       T01028                                 

Gene name
PRKACA, PKA, PKACA
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04020  Calcium signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04114  Oocyte meiosis
mcc04140  Autophagy - animal
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04310  Wnt signaling pathway
mcc04340  Hedgehog signaling pathway
mcc04371  Apelin signaling pathway
mcc04530  Tight junction
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04714  Thermogenesis
mcc04720  Long-term potentiation
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04726  Serotonergic synapse
mcc04727  GABAergic synapse
mcc04728  Dopaminergic synapse
mcc04740  Olfactory transduction
mcc04742  Taste transduction
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04910  Insulin signaling pathway
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04919  Thyroid hormone signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04924  Renin secretion
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing's syndrome
mcc04961  Endocrine and other factor-regulated calcium reabsorption
mcc04962  Vasopressin-regulated water reabsorption
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04976  Bile secretion
mcc05012  Parkinson's disease
mcc05020  Prion diseases
mcc05030  Cocaine addiction
mcc05031  Amphetamine addiction
mcc05032  Morphine addiction
mcc05146  Amoebiasis
mcc05165  Human papillomavirus infection
mcc05166  HTLV-I infection
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05205  Proteoglycans in cancer
mcc05414  Dilated cardiomyopathy (DCM)
Module
mcc_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    718632 (PRKACA)
   04010 MAPK signaling pathway
    718632 (PRKACA)
   04310 Wnt signaling pathway
    718632 (PRKACA)
   04340 Hedgehog signaling pathway
    718632 (PRKACA)
   04371 Apelin signaling pathway
    718632 (PRKACA)
   04020 Calcium signaling pathway
    718632 (PRKACA)
   04024 cAMP signaling pathway
    718632 (PRKACA)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    718632 (PRKACA)
  Cell growth and death
   04114 Oocyte meiosis
    718632 (PRKACA)
  Cellular community - eukaryotes
   04530 Tight junction
    718632 (PRKACA)
   04540 Gap junction
    718632 (PRKACA)
 Organismal Systems
  Immune system
   04611 Platelet activation
    718632 (PRKACA)
   04062 Chemokine signaling pathway
    718632 (PRKACA)
  Endocrine system
   04911 Insulin secretion
    718632 (PRKACA)
   04910 Insulin signaling pathway
    718632 (PRKACA)
   04922 Glucagon signaling pathway
    718632 (PRKACA)
   04923 Regulation of lipolysis in adipocyte
    718632 (PRKACA)
   04912 GnRH signaling pathway
    718632 (PRKACA)
   04913 Ovarian Steroidogenesis
    718632 (PRKACA)
   04915 Estrogen signaling pathway
    718632 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    718632 (PRKACA)
   04921 Oxytocin signaling pathway
    718632 (PRKACA)
   04926 Relaxin signaling pathway
    718632 (PRKACA)
   04918 Thyroid hormone synthesis
    718632 (PRKACA)
   04919 Thyroid hormone signaling pathway
    718632 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    718632 (PRKACA)
   04916 Melanogenesis
    718632 (PRKACA)
   04924 Renin secretion
    718632 (PRKACA)
   04925 Aldosterone synthesis and secretion
    718632 (PRKACA)
   04927 Cortisol synthesis and secretion
    718632 (PRKACA)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    718632 (PRKACA)
   04270 Vascular smooth muscle contraction
    718632 (PRKACA)
  Digestive system
   04970 Salivary secretion
    718632 (PRKACA)
   04971 Gastric acid secretion
    718632 (PRKACA)
   04976 Bile secretion
    718632 (PRKACA)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    718632 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    718632 (PRKACA)
  Nervous system
   04724 Glutamatergic synapse
    718632 (PRKACA)
   04727 GABAergic synapse
    718632 (PRKACA)
   04725 Cholinergic synapse
    718632 (PRKACA)
   04728 Dopaminergic synapse
    718632 (PRKACA)
   04726 Serotonergic synapse
    718632 (PRKACA)
   04720 Long-term potentiation
    718632 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    718632 (PRKACA)
  Sensory system
   04740 Olfactory transduction
    718632 (PRKACA)
   04742 Taste transduction
    718632 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    718632 (PRKACA)
  Aging
   04211 Longevity regulating pathway - mammal
    718632 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    718632 (PRKACA)
  Environmental adaptation
   04713 Circadian entrainment
    718632 (PRKACA)
   04714 Thermogenesis
    718632 (PRKACA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    718632 (PRKACA)
   05205 Proteoglycans in cancer
    718632 (PRKACA)
   05203 Viral carcinogenesis
    718632 (PRKACA)
  Neurodegenerative diseases
   05012 Parkinson's disease
    718632 (PRKACA)
   05020 Prion diseases
    718632 (PRKACA)
  Substance dependence
   05030 Cocaine addiction
    718632 (PRKACA)
   05031 Amphetamine addiction
    718632 (PRKACA)
   05032 Morphine addiction
    718632 (PRKACA)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    718632 (PRKACA)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    718632 (PRKACA)
  Infectious diseases
   05166 HTLV-I infection
    718632 (PRKACA)
   05163 Human cytomegalovirus infection
    718632 (PRKACA)
   05169 Epstein-Barr virus infection
    718632 (PRKACA)
   05165 Human papillomavirus infection
    718632 (PRKACA)
   05146 Amoebiasis
    718632 (PRKACA)
  Drug resistance
   01522 Endocrine resistance
    718632 (PRKACA)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     718632 (PRKACA)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: AGC group
  PKA family
   718632 (PRKACA)
Messenger RNA biogenesis [BR:mcc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     718632 (PRKACA)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    718632 (PRKACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 718632
NCBI-ProteinID: XP_014978605
Ensembl: ENSMMUG00000014132
UniProt: H9EQQ4
Position
19
AA seq 351 aa AA seqDB search
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgccgccgccgccaagaagggcagcgagcaggagagcgtgaaagaattctta
gccaaagccaaagaagattttcttaaaaaatgggaaagtcccgctcagaacacagcccac
ttggatcagtttgaacgaatcaagaccctcggcacgggctccttcgggcgggtgatgctg
gtgaaacacaaggagaccgggaaccactatgccatgaagatcctcgacaaacagaaggtg
gtgaagctgaaacagatcgaacataccctgaatgaaaagcgcatcctgcaagccgtcaac
tttccgttcctcgtcaaactcgagttctccttcaaggacaactcaaacttatacatggtc
atggaatacgtgcccggtggggagatgttctcacacctacggcggattggaaggttcagc
gagccccatgcccgtttctacgcggcccagatcgtcctgaccttcgagtatctgcactcg
ctggatctcatctacagggacctgaagccggagaatctgctcattgaccagcagggatac
attcaggtgacagacttcggtttcgccaagcgcgtgaagggccgcacttggaccttgtgc
ggcacccctgagtatctggcccctgagattatcctgagcaaaggctacaacaaggctgtg
gactggtgggccctgggggttcttatctatgaaatggccgctggctacccgcccttcttc
gcagaccagcccatccagatctatgagaagatcgtctctgggaaggtgcggttcccttcc
cacttcagctctgacttgaaggacctgctgcggaacctcctgcaggtagatcttaccaag
cgctttgggaacctcaagaatggggtcaatgatatcaagaaccacaagtggtttgccacg
actgactggatcgccatctaccagaggaaggtggaagctcccttcataccaaagtttaaa
ggccctggggatacgagtaactttgacgactatgaggaagaagaaatccgggtctccatc
aatgagaagtgtggcaaggagttttctgagttttag

DBGET integrated database retrieval system