KEGG   Macaca mulatta (rhesus monkey): 719006Help
Entry
719006            CDS       T01028                                 

Gene name
ZBTB7B
Definition
(RefSeq) zinc finger and BTB domain-containing protein 7B isoform X4
  KO
K10494  zinc finger and BTB domain-containing protein 7
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    719006 (ZBTB7B)
   04121 Ubiquitin system [BR:mcc04121]
    719006 (ZBTB7B)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    719006 (ZBTB7B)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     719006 (ZBTB7B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTB zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz GAGA zf-met DUF3268 Zn-ribbon_8
Motif
Other DBs
NCBI-GeneID: 719006
NCBI-ProteinID: XP_001112511
Ensembl: ENSMMUG00000004053
Position
1
AA seq 539 aa AA seqDB search
MGSPEDDLIGIPFPDHSSELLSCLNEQRQLGHLCDLTIRTQGLEYRTHRAVLAACSHYFK
KLFTEGGGGAVMGAGGSGTATGGAGAGVCELDFVGPEALGALLEFAYTATLTTSSANMPA
VLQAARLLEIPCVIAACMEILQGSGLEAPSPDEDDCERARQYLQAFATATASGVPNGEDS
PPQVPLPPPPPPPPRPVARRSRKPRKAFLQTKGARANHLVPEVPAVPAHPLTYEEEEVVG
RVGSSGGSGLGDSYSPPTGTASPPEGPQSYEPYEGEEEEEELVYPPAYGLAQGGGPPLSP
EELGSDEDAIDPDLMAYLSSLHQDNLAPGLDGQDKLVRKRRSQMPQECPVCHKIIHGAGK
LPRHMRTHTGEKPFACEVCGVRFTRNDKLKIHMRKHTGERPYSCPHCPARFLHSYDLKNH
MHLHTGDRPYECHLCHKAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSTAAAS
PAGLDLSNGHLDTFRLSLARFWEQSAPTGPPVSTPGPPDDDEEEGAPTTPQAEGAMESS
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggggagccccgaggatgacctgattgggattccattcccggaccacagcagtgagctc
ctgagctgcctcaatgagcagcgccagctgggccacctatgtgacctcaccatccggacg
cagggccttgaataccgcacccacagggctgtgctagctgcctgtagccactacttcaag
aagctattcactgagggcggtggcggagctgtcatgggggccgggggcagcgggacagcc
actgggggagcaggagcaggcgtgtgtgagctggactttgtagggccagaggcactaggc
gccctccttgaatttgcctatacagccacactgaccaccagcagcgccaacatgccagct
gtgctccaggctgcccgcctgctggagatcccgtgtgtcatcgctgcttgcatggagatt
ctgcagggcagtgggctagaagctcccagcccagacgaggatgactgtgagcgagcccgc
cagtatctgcaggcctttgccacagccacagcctctggagttcccaatggtgaagacagt
cctccacaggtgcccctcccaccacctccaccaccgccacctcggcctgttgcccgccgc
agccgcaagccccggaaagctttcctgcaaaccaagggggccagagcaaaccacctagtc
cctgaggtgcccgcagtacctgcccatcccttgacctatgaggaggaggaggtggtgggt
agagtgggcagcagtgggggcagtgggctgggggacagctacagccctcccacaggaacc
gcctcccctcctgaggggccccagagctacgaaccctatgagggtgaggaagaagaagag
gagctggtatatcccccagcctatgggctggcgcagggtggcgggcccccgctgtcccca
gaggagctgggctcagatgaggatgccatcgatcctgacctgatggcctacctaagctcc
ctgcaccaggacaacctggcaccaggcctggatggccaagacaagctggtgcgcaaacgc
cgctcccagatgcctcaggagtgtcctgtctgccacaagatcatccatggggcgggcaaa
ctgcctcgccacatgaggacccacacaggcgagaagccctttgcctgcgaggtctgcggt
gttcgattcacccggaacgacaagctgaagatccacatgcggaagcacacgggagagcgc
ccctactcgtgcccgcactgcccagcccgcttcctgcacagctacgacctcaagaaccac
atgcacctgcatacgggggaccggccctatgagtgccacctgtgccacaaggctttcgcc
aaggaggaccacctgcagcgccacctcaaaggccagaactgcctggaggtgcgcacccga
cggcgccgcaaggacgatgcaccaccccactacccgccaccctctacggctgctgcatcc
cccgctggcctcgacctctccaatggccacctggacaccttccgcctctctctagctcga
ttctgggagcagtcagcccccaccgggcccccggtctctaccccggggccccctgatgac
gatgaggaggaaggggcacccaccacaccccaggctgaaggtgctatggagtcctcttaa

DBGET integrated database retrieval system