KEGG   Macaca mulatta (rhesus monkey): 719429Help
Entry
719429            CDS       T01028                                 

Gene name
CPT1C
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, brain isoform isoform X2
  KO
K19524  carnitine O-palmitoyltransferase 1, brain isoform [EC:2.3.1.21]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00071  Fatty acid degradation
mcc01212  Fatty acid metabolism
mcc03320  PPAR signaling pathway
mcc04152  AMPK signaling pathway
mcc04714  Thermogenesis
mcc04920  Adipocytokine signaling pathway
mcc04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    719429 (CPT1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    719429 (CPT1C)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    719429 (CPT1C)
   04920 Adipocytokine signaling pathway
    719429 (CPT1C)
   03320 PPAR signaling pathway
    719429 (CPT1C)
  09159 Environmental adaptation
   04714 Thermogenesis
    719429 (CPT1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mcc03029]
    719429 (CPT1C)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     719429 (CPT1C)
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    719429 (CPT1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 719429
NCBI-ProteinID: XP_014980084
Ensembl: ENSMMUG00000014735
UniProt: F7G7U0
Position
19
AA seq 803 aa AA seqDB search
MAEAHQAVGFRTSLTSDGAEVELSAPVLQEIYLSGLRSWKRHLSRFWNDFLTGVFPASPL
SWLFLFSAIQLAWFLQLDPSLGLMEKIKELLPDWGGQHHGLRGVLAAALFASCLWGTLIF
TLHVALRLLLSYHGWLLEPHGAMSSPTKTWLALVRIFSGRHPMLFSYQRSLPRQPVPSVQ
DTVRKYLESVRPVLSDEDFDWTAVLAQEFLRLQASLLQWYLRLKSWWASNYVSDWWEEFV
YLRSRNPLMVNSNYYMMDFLYVTPTPLQAARAGNAVHALLLYRHRLNRQEIPPTLLMGMR
PLCSAQYEKIFNTTRIPGVQKDYIRHLHDSQHVAVFHRGRFFRVGTHSRNSLLSPRALEQ
QFQRILDDPSPACPHEEHLAALTAAPRGTWAQVRRSLKTQAAEALEAVEGAAFFVSLDAE
PAGLTREDPAASLDAYAHALLAGRGHDRWFDKSFTLIVFSNGKLGLSVEHSWADCPISGH
MWEFTLATECFQLGYSTDGHCKGHPDPTLPRPQRLQWDLPDQIHSSISLALRGAKILSEN
VDCHVFPFSLFGKSFIRRCHLSSDSFIQIALQLAHFRDRGQFCLTYESAMTRLFLEGRTE
TVRSCTREACNFVRAMEDKEKTDPQCLALFRVAVDKHQALLKAAMSGQGVDRHLFALYVV
SRFLHLQSPFLTQVHSEQWQLSTSQIPVQQMHLFDVHNYPDYVSSGGGFGPADDHGYGVS
YIFMGDDMITFHISSKKSSTKTDSHRLGQHIEDALLDVASLFQAGQHFKRRFRGSGKEDS
RHRCGFLSRQTGASKTSMTSTYF
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcgcaccaggccgtgggcttccgaacctcgctgacctcggacggggctgaa
gtggaactcagtgcccctgtgctgcaggagatctacctctctggcctgcgctcctggaaa
aggcatctctcacgtttctggaatgactttctcaccggtgtgtttcctgccagccccctc
agttggcttttcctcttcagtgccatccagcttgcctggttcctccagctggatccttcc
ttaggactgatggagaagatcaaagagttgctgcccgactggggcggacagcaccacggg
ctccggggggtcctggcagctgctctgtttgcctcttgtttgtggggaaccctgatcttc
acactgcacgtggccctcaggctgcttctgtcctaccacggctggcttcttgagccccac
ggagccatgtcctcccccaccaagacctggctggccctggtccgcatcttctccggccgc
cacccgatgctgttcagttaccagcgctccctgccgcgccagcccgtgccctctgtgcag
gacaccgtgcgcaagtacctggagtcggtccggcccgtcctctccgacgaggacttcgac
tggaccgcggtcctggcgcaggaattcctgaggctgcaggcgtcgctgctgcagtggtac
ctgaggctcaagtcctggtgggcgtccaattatgtcagtgactggtgggaggaatttgtg
tacctgcgctcccgaaatccgctgatggtgaacagcaactattacatgatggacttcctg
tatgtcacacccacgcctctgcaggcagctcgcgctgggaatgccgtgcacgccctcctc
ctgtaccgccaccgcctgaaccgccaggagatacccccgactttgctaatgggaatgcgt
cccttatgctctgcccagtatgagaagatcttcaataccacgcggattccaggggtccaa
aaagactacatccgccacctccatgacagccaacacgtggctgtcttccaccggggccga
ttcttccgcgtggggacccactcccgaaacagcctgctttccccgagggccctggagcag
cagtttcagcgaatcctggacgatccctcaccagcctgcccccacgaggaacatctggct
gctctgaccgctgctcccaggggcacgtgggcccaggtgcgaaggtccctgaagacccag
gcagcagaggccctggaggcagtggaaggggccgctttctttgtgtcactggacgctgag
cccgcggggctcaccagggaggacccagcagcgtcgttggatgcctatgcccatgccctg
ctggctggccggggccatgaccgctggtttgacaaatccttcaccctaatcgtcttctct
aacgggaagctgggcctcagcgtggagcactcctgggccgactgccccatctcaggacac
atgtgggagttcactctggctacagaatgctttcagctgggctactcaacagacggccac
tgcaaggggcacccggaccccacactaccccggccccagcggctgcaatgggaccttcca
gaccagatccactcctccatctctctagccctgaggggagccaagatcttgtctgaaaat
gtcgactgccatgtctttccattctccctatttggcaagagcttcatccgacgctgccac
ctctcttcagacagcttcatccagatcgccttgcaactggcccacttccgggacaggggt
caattctgcctgacttatgagtcggccatgactcgcttattcctggaaggccggacggag
acggtgcgatcttgcacgagggaggcctgcaactttgtgagggccatggaggacaaagag
aagacggacccacagtgccttgccctgtttcgcgtggcagtggacaagcaccaggctctg
ctgaaggcagccatgagcgggcagggagtcgaccgccacctctttgcgctctacgtcgtg
tcccgattcctccacctgcagtcgcccttcctgacccaggtccattcggagcagtggcag
ctgtccaccagccagatccctgttcagcaaatgcatctgtttgacgtccacaattacccg
gactatgtttcttcgggcggtggattcgggcctgctgatgaccatggttatggtgtttct
tatatcttcatgggggatgacatgatcaccttccacatctccagcaaaaaatcaagcaca
aaaacggattcccacaggctggggcagcacattgaggacgcactgttggatgtggcctcc
ctgttccaggcgggacagcattttaagcgccggttcagagggtcagggaaggaggactcc
aggcacaggtgtggatttctctcccgccagactggggcctccaagacatcaatgacatcc
acctacttctga

DBGET integrated database retrieval system