KEGG   Macaca mulatta (rhesus monkey): 719697Help
Entry
719697            CDS       T01028                                 

Gene name
NFYA
Definition
(RefSeq) nuclear transcription factor Y subunit alpha
  KO
K08064  nuclear transcription factor Y, alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04612  Antigen processing and presentation
mcc05017  Spinocerebellar ataxia
mcc05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    719697 (NFYA)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    719697 (NFYA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    719697 (NFYA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    719697 (NFYA)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    719697 (NFYA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBFB_NFYA
Motif
Other DBs
NCBI-GeneID: 719697
NCBI-ProteinID: NP_001181656
Ensembl: ENSMMUG00000021173
UniProt: F7H6J8
Position
4
AA seq 318 aa AA seqDB search
MEQYTANSNSSTEQIVVQAGQIQQQVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQT
IMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQ
QQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGAN
TNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNA
KQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHM
QDPNQADEEAMTQIIRVS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggagcagtatacagcaaacagcaatagttcgacagagcagattgttgtccaggcagga
cagattcagcagcaggtccaagggcagccattaatggtgcaggtcagtggaggccagcta
atcacatcaactggccaacccatcatggtccaggctgtccctggtggacaaggtcaaacc
atcatgcaagtacctgtttctggaacacagggtttgcagcagatacagttggtcccacct
ggacagatccagatccagggtggacaggctgtgcaggtgcagggccagcagggccagaca
cagcagatcatcatccagcagccccagacggccgtcactgctggccagactcagacacag
cagcagatcgctgtccagggacagcaagtggcacagactgctgaagggcagaccattgtc
tatcagccggttaatgcagatggcaccattctccagcaagttacagtccctgtttcaggc
atgatcactatcccagcagccagtttggcaggagcacagattgttcagacaggagccaat
accaacacaaccagcagtgggcaagggactgtcactgtgacactaccagtggcaggcaat
gtggtcaattcaggagggatggtcatgatggttcctggggctggctctgtgcctgctatc
caaagaatccctctacctggagcagagatgcttgaagaagagcctctctacgtgaatgcc
aaacaataccaccgtattcttaagaggaggcaagcccgggctaaactagaggcagaaggg
aaaattccaaaggaaagaaggaaatacctgcatgagtctcggcaccgtcatgccatggca
cggaagcgtggtgaaggtggacgatttttctctccaaaggaaaaggatagtccccatatg
caggatccaaaccaagccgatgaagaagcaatgacacagatcatccgagtgtcctaa

DBGET integrated database retrieval system