KEGG   Macaca mulatta (rhesus monkey): 721470
Entry
721470            CDS       T01028                                 
Symbol
EHMT1
Name
(RefSeq) histone-lysine N-methyltransferase EHMT1 isoform X1
  KO
K11420  [histone H3]-lysine9 N-trimethyltransferase EHMT [EC:2.1.1.355]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00310  Lysine degradation
mcc01100  Metabolic pathways
mcc04211  Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    721470 (EHMT1)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    721470 (EHMT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcc03036]
    721470 (EHMT1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.355  [histone H3]-lysine9 N-trimethyltransferase
     721470 (EHMT1)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     721470 (EHMT1)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_3 Ank Ank_5 SET Pre-SET
Other DBs
NCBI-GeneID: 721470
NCBI-ProteinID: XP_014971696
Ensembl: ENSMMUG00000019613
Position
15:complement(364817..593838)
AA seq 1312 aa
MARGRGGATLRARAMAAADAEAVPARGEPQQDCCVKTELLGEETPMAADEGSAEKQAGEA
HMAADGETNGSCENSDASSHANAAKHTQDSARVNPQDGTNTLTRIAENGVSERDSEAGKQ
NHVTADDFVQTSVIGSNGYILNKPALQAQPLRTTSTLASSLPGHAAKTLPGGAGKGRTPS
AFPQTPAAPPATLGEGSADTEDRKPPAPGADVKVHRARKTMPKSVVGLHAASKDPREVRE
ARDHKEPKEEINKNISDFGRQQLLPPFPSLHQSLPQNQCYMATTKSQTACLPFVLAAAVS
RKKKRRMGTYSLVPKKKTKVLKQRTVIEMFKSITHSTVGSKGEKDLGASSLHVNGESLEM
DSDEDDSEELEEDDGHGAEQAAAFPTEDSRTSKESMSEADRAQKMDGESEEEQESVDTGE
EEEGGDESDLSSESSLKKKFLKRKGKTDSPWIKPARKRRRRSRKKPSGALGSESYKSSSG
SGEQMAPGDSTGYMEVSLDSLDLRVKGILSSQAEGLANGPDVLETDGLQEVPLCSCRMET
PRSREISTLANNQCMATESVDHELGRCTNSVVKYELMRPSNKAPLLVLCEDHRGRMVKHQ
CCPGCGYFCTAGNFMECQPESSISHRFHKDCASRVNNASYCPHCGEESSKAKEVTIAKAD
TTSTVTPVPGQEKGSALEGRADTTTGSAAGPPLSEDDKLQGTASHMPEGFDPTGPAGLGR
PTPGLSQGPGKETLESALIALDSEKPKKLRFHPKQLYFSARQGELQKVLLMLVDGIDPNF
KMEHQNKRSPLHAAAEAGHVDICHMLVQAGANIDTCSEDQRTPLMEAAENNHLEAVKYLI
KAGALVDPKDAEGSTCLHLAAKKGHYEVVQYLLSNGQMDVNCQDDGGWTPMIWATEYKHV
DLVKLLLSKGSDINIRDNEENICLHWAAFSGCVDIAEILLAAKCDLHAVNIHGDSPLHIA
ARENRYDCVVLFLSRDSDVTLKNKEGETPLQCASLNSQVWSALQMSKALQDSAPDRPSPV
ERIVSRDIARGYERIPIPCVNAVDGEPCPSNYKYVSQNCVTSPMNIDRNITHLQYCVCID
DCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRA
RLQLYRTRDMGWGVRSLQDIPLGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYC
IDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERF
WDIKGKLFSCRCGSPKCRHSSAALAQRQASAAQEAQEDGLPDTSSAAAADPL
NT seq 3939 nt   +upstreamnt  +downstreamnt
atggcgcgcgggaggggcggggccacgctgcgggcccgggccatggccgccgccgatgcc
gaggcagttccggcgaggggggagcctcagcaggattgctgtgtgaaaaccgagctgctg
ggagaagagacacctatggctgccgatgaaggctcagcagagaaacaggcaggagaggcc
cacatggctgcggacggtgagaccaacgggtcttgtgaaaacagtgatgccagcagccat
gcaaatgctgcaaaacacactcaggacagcgcaagggtcaacccccaggatggcaccaac
acactaacccggatagcggaaaacggggtttcagaaagagactcagaagcagggaagcaa
aaccacgtcactgccgatgactttgtgcagacttctgtcatcggcagcaacggatacatc
ttaaataagccggccctgcaggcccagcccttgaggactaccagcactctggcctcttcg
ctgcctggccatgctgcaaaaacccttcctggaggggctggcaaaggcaggactccaagc
gcttttccccagacgccagccgccccaccagccacccttggggaggggagtgctgacaca
gaggacaggaagcccccggcccctggcgccgatgtcaaggtccacagggcacgcaagacc
atgccgaagtccgtcgtgggcctgcatgcagccagtaaagatcccagagaagttcgagaa
gctagagatcataaggaaccaaaagaggagatcaacaaaaacatttctgactttggacga
cagcagcttttaccccccttcccatcccttcatcagtcgctacctcagaaccaatgctac
atggccaccacaaaatcacagacagcttgcttgccttttgttttagcagctgcagtatct
cggaagaaaaaacgaagaatgggaacctatagcctggttcctaagaaaaagaccaaagta
ttaaaacagaggacagtgattgagatgtttaagagcataactcattccactgtgggttct
aagggggagaaggacctgggcgccagcagcctgcacgtgaatggggagagcttggagatg
gactcagacgaggacgactcagaggagctcgaggaggacgacggccacggcgcggagcag
gcggctgcgttccccacggaggacagcaggacttccaaggagagcatgtcggaggctgac
cgcgcccagaagatggacggggagtctgaggaggagcaggagtccgtggacaccggggag
gaggaggaaggcggtgacgagtctgacctgagttcggaatccagcctcaagaagaaattt
ctcaagaggaaaggaaagaccgacagtccctggatcaagccagccaggaaaaggaggcgg
agaagtagaaagaagcccagcggtgccctcggttctgagtcgtataagtcatcttcagga
agcggtgagcagatggcaccaggagacagcacagggtacatggaagtttctctggactcc
ctggatctccgcgtcaaaggaattctgtcttcacaagcagaagggttggccaacggtcca
gatgtgctggagacagacggcctccaggaagtgcctctctgcagctgccggatggaaaca
ccgaggagccgagagatctccactctggccaacaaccagtgcatggctaccgagagcgtg
gaccacgaattgggccggtgcacaaacagcgtggtcaagtatgagctgatgcgcccatcc
aacaaggccccgctccttgtgctgtgtgaagaccaccggggccgcatggtgaagcaccag
tgctgtcccggctgtggctacttctgcacagcgggtaattttatggagtgtcagcccgag
agcagcatctctcaccgtttccacaaagactgtgcctctcgcgtcaataacgccagctat
tgtccccactgtggggaggagagctccaaggccaaagaggtgacgatagctaaagcagac
accacctctaccgtgacaccagtccccgggcaggagaagggctcagccctggagggcagg
gccgacaccacaacgggcagtgctgctgggccaccactctcggaggacgacaagctgcag
ggtacagcctcccacatgcccgagggctttgatccaacgggacctgctgggctcgggagg
ccaacccctggcctttcccagggaccagggaaggaaaccttggagagtgctctcatcgcc
ctcgactcggaaaaacccaagaagcttcgcttccacccaaagcagctgtacttctccgcc
aggcaaggggagcttcagaaggtgctcctcatgctggtggacggaattgaccccaacttc
aaaatggagcaccagaataagcgctccccactgcacgcggcggcggaggctggacacgtg
gacatctgccacatgctggttcaggcgggcgctaatatcgacacctgctcagaagaccag
aggaccccgttgatggaagcagccgaaaacaaccatctggaagcagtgaagtacctcatc
aaggccggggccctggtggatcccaaggacgcagagggctctacgtgtttgcacctggct
gccaagaaaggccactacgaagtggtccagtacttgctttcaaatggacagatggacgtc
aactgtcaggatgacggaggctggacgcctatgatctgggccacggagtacaagcacgtg
gacctcgtgaagctgctgctgtccaagggctccgacatcaacatccgggacaacgaggag
aacatttgcctgcactgggcggcgttctctggctgcgtggacatcgccgaaatcctgctg
gctgccaagtgcgacctccacgccgtgaacatccacggagactcgccgctgcacattgct
gcccgggagaaccgctacgactgtgtcgtcctctttctttctcgggattcagatgtcacc
ttaaagaacaaagaaggggagacgcccctgcagtgtgcgagcctcaactctcaggtgtgg
agcgctctgcagatgagcaaggctctgcaggactcggcccccgacaggcccagccccgtg
gagaggatagtgagcagggacatcgctcgaggctacgagcgtatccccatcccctgcgtc
aacgccgtggatggcgagccgtgccccagcaactacaagtacgtctctcagaactgcgtg
acgtcccccatgaacatcgacagaaacatcactcacctgcagtactgtgtgtgcatcgac
gactgttcctccagcaactgcatgtgcggccagctcagcatgcgctgctggtacgacaag
gacggccggctcctgccagagttcaacatggcggagcctcccttgatcttcgaatgcaac
cacgcgtgctcctgctggaggaactgccgaaatcgtgtcgtgcagaatggtctcagggca
aggctgcagctctaccggacgagggacatgggctggggcgtgcggtccctgcaggacatc
ccactaggcacctttgtctgcgagtatgttggggagctgatttcggactcagaagccgat
gttcgggaggaagattcttacctctttgatctcgacaataaggacggggaggtttactgc
atcgacgcgcggttctacgggaacgtcagccggttcatcaaccaccactgcgagcccaac
ctggtgcccgtgcgcgtgttcatggcccaccaggacctgcggttcccccggatcgccttc
ttcagcacccgcctgatcgaggccggcgaacagctcgggtttgactacggagagcgcttc
tgggacatcaaaggcaagctcttcagctgccgctgcggctcccccaagtgccggcactcg
agcgcggccctggcccagcgtcaggccagcgcggcccaggaggcccaggaggacggcctg
cccgacaccagctccgcggctgccgccgacccgctatga

DBGET integrated database retrieval system