KEGG   Macaca mulatta (rhesus monkey): 721985
Entry
721985            CDS       T01028                                 

Gene name
TM7SF2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00100  Steroid biosynthesis
mcc01100  Metabolic pathways
Module
mcc_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    721985 (TM7SF2)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     721985 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 721985
NCBI-ProteinID: XP_014969294
Ensembl: ENSMMUG00000018773
UniProt: G7NCG0 A0A663DA95
Position
14
AA seq 481 aa
MHRPVPAPHGTQALVSARWSPQAGAGAAGPDPPRGQVHLLGNGADCVSLTDYCERPLSGG
AETMAPPEGPRAPLEFGGPLGAAALLLLLPATMFHLLLAARSGPARLLGPPASLPGLEAL
WSPRALLLWLAWLGLQAALYLLPARKVAEGQELKDKSRLRYPINGFQALVLTALLVGLGV
SAGLPLGALPEMLLPLAFVATLTAFIFSLFLYMKAQVAPVSALAPGGISGNPIYDFFLGR
ELNPRICFFDFKYFCELRPGLIGWVLINLALLVKEAELRGSPSLAMWLVNGFQLLYVGDA
LWHEEAILTTMDITHDGFGFMLAFGDIAWVPFTYSLQAQFLLRHPQPLGLPMASAICLIN
AIGYYIFRGANSQKNTFRKNPSDPRVAGLETISTATGRKLLVSGWWGMVRHPNYLGDLIM
ALAWSLPCGVSHLLPYFYLLYFTALLVHREARDERQCLQKYGLAWQEYCRRVPYRIVPYI
Y
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgcacaggcctgtcccggcgccccatggcacccaggctctggtctccgcccggtggtcc
ccgcaggcaggtgcaggcgccgcggggccggatcctccgcgcggacaagtccatctcctg
ggaaatggggcggactgtgtttccttgaccgactattgtgagcgccctctctccggcgga
gcggagaccatggcccctcctgagggcccccgggccccgctggaattcggagggcccctg
ggcgccgcggctctgctgctgctgctgcccgccaccatgttccacctgctcctggcggcc
cgttcgggccccgcgcgcctgctgggtccacccgcgtccctgcctgggctggaggcgctg
tggagcccacgggcgctgctgctgtggctcgcctggctcggcctgcaggcggcgctctac
ctactgccggcgcgcaaggtggctgaggggcaggaattgaaggacaagagtcgcctgcgc
tatccgattaacggcttccaggccctggtgctgacagccctgttggtggggctgggggtg
tcagcggggctgcctctgggggcgctcccggaaatgctcctgcctttggcgtttgtcgcc
accctcaccgctttcatcttcagcctctttctctacatgaaggcgcaggtagccccagtt
tcggccctggcacctggggggatctcaggcaatccgatttacgacttttttctgggacgg
gagctcaaccctcgtatctgtttcttcgacttcaaatatttctgtgaactgcgacctggc
ctcatcggctgggtcctcatcaacctggccctgttggtgaaggaggcagaacttcggggc
agtccctcactggccatgtggctggttaatggcttccagttactctatgtgggtgatgcc
ctctggcatgaggaggccatcctcaccaccatggatatcacacatgacgggtttggcttc
atgctggcatttggggacatagcctgggtgcccttcacctacagcctgcaagcccagttc
ctgctgcgccacccgcagcccctggggttgcccatggcttccgccatctgcctcatcaat
gctattggttactacatcttccgtggggcgaattcccagaaaaacactttccgaaagaat
ccttctgaccccagagtggctgggcttgagaccatctctacagccacagggcggaaactg
ctggtgtctgggtggtggggtatggtccgccatcccaactaccttggagacctcatcatg
gctctggcttggtccttgccctgtggggtgtcacacctgctgccctacttctacctcctc
tacttcaccgcgctgctggtgcaccgtgaggcccgggatgagcggcagtgcctgcagaag
tatggcctggcatggcaggagtactgccggcgtgtgccttaccgcatcgtgccctacatc
tactga

DBGET integrated database retrieval system