KEGG   Macaca mulatta (rhesus monkey): 722202
Entry
722202            CDS       T01028                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcc01002]
    722202 (ADAMTS13)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     722202 (ADAMTS13)
Peptidases and inhibitors [BR:mcc01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   722202 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin TSP1_spondin Reprolysin_4 Reprolysin_3 Reprolysin_5 TSP1_CCN Reprolysin_2 Peptidase_M10
Other DBs
NCBI-GeneID: 722202
NCBI-ProteinID: XP_014971920
Ensembl: ENSMMUG00000000937
Position
15
AA seq 1431 aa
MSQRHPRARCPSLCVAGILACGFLLGCWGPSHFQQSFLQALEPQAVSSYLSSGAPLKGHP
PSPGFQRQRQRQRQRQRRAAGSILHLELLVAVGPDVFQAHQEDTERYVLTNLNIGAELLR
DPSLGAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSRTINPEDDTDPGHADLVL
YITRFDLELPDGNRQVRGVTQLGGACSPTWSCLITEDTGFDLGVTIAHEIGHSFGLEHDG
TPGSGCGPSGHVMASDGAAPRAGLAWSPCSRRQLLSLLSAGRARCVWDPPRPQPGSAGRQ
PEAQPGLYYSANEQCRVAFGPKAVACTFSREHLDMCQALSCHTDPLDQSSCSRLLVPLLD
GTECGMEKWCSKGRCRSLVELTPIAAVHGHWSSWGPQSPCSRSCGGGVVTRRRQCNNPRP
AFGGRACVGADLQAEMCNTQACEKTQLEFMSEQCARTDNQPLHSSPGGASFYHWGAAVPH
SQGDALCRHMCRAVGESFIMKRGDSFLDGTRCVPSGPQEDGTLSLCVSGSCRTFGCDGRM
DSQQVRDVCQVCGGDNSTCSPRNGSFTAGRAREYVTFLTVTPNLTSVYIANHRPLFTHLA
VRIGGRYVVAGKTSISSNTTYPSLLEDGRVEYRVALTKDRLPHLEEIRIWGPLQEDAEIQ
VYRRYGEEYGNLTCPDITFTYFQPKPRQAWVWAAVRGPCSVSCGAGLRWVNYSCLDQARK
ELVETARCQGSQQPPAWPEACMLEPCPPYWAVGDFGPCSVSCGGGLRERPVRCVEAQGSL
LKTLPPARCTAGAQQPAVAVEICNPQPCPARWEVSEPGPCTSASGAGPALQNETCVPGAD
GLEAPATEGPDSVDEKLPAPEPCVGMSCPAGWGHLDATSAGEEAPSPWGSIRTGAQAAHV
WTPLAGPCSVSCGRGLMELRFLCMDAALRVPVQEELCGLASKPGSRREVCQAVPCPARWQ
YKLAACSVSCGGGVMRRILYCARAHGEDEEEEILLDTQCQGLPRPDPQEACSLEPCPPRW
KVMSLGPCSASCGLGTARRSVACVQLDQGQDVEVDEAACAALVRPQASVPCLIADCTYRW
YVGTWTECSVSCGDGIQRRHDTCLGPQAQAPVPVDFCQHLPKPVTVRGCWAGPCVGQGTP
NLVPHEEATAPGQTTATPAGASLEWSQAPALLFSPAPQPRRLLPGPQESSAQSSACGRQH
LEPTGTIDMRGPGQADCAVAIGRPLGEVVTLRVLESSLNCSAGDMLLLWGRLTWRKMCRK
LLGMTFSSKTNTLVVRQRCRQPGAGVLLRYGSQLAPETFYRECDMQLFGPWGEIVSPSLS
PATSKAGGCRLFINVAPHARIAIHALATNMDNGTKGANASYISIRDIHSLRTTTFHGQQV
LYWESESSQAEMEFSEDFLKAQASLRGQYWTLQSWVPEGQDPQSWKGKEGT
NT seq 4296 nt   +upstreamnt  +downstreamnt
atgagccagcgtcacccccgggcaagatgcccttccctctgtgtggccggaatccttgcc
tgtggctttctcctgggctgctggggaccctcccatttccagcagagttttcttcaggca
ttggagccacaggctgtgtcttcttacttgagctctggtgctcccttaaaaggccaccct
ccctcccccggcttccagaggcagaggcagaggcagaggcagaggcagaggcgggctgca
ggcagcatcctacacctggagctgctggtggccgtgggccccgatgtcttccaggctcac
caggaggacacagagcgctacgtgctcaccaacctcaacatcggggcagaactgcttcgg
gacccgtccctgggggctcagtttcgggtgcacctggtgaagatggtcattctgacagag
cccgagggtgctccaaatatcacagccaaccttacctcgtccctgctgagcgtctgtggg
tggagccggaccatcaaccccgaggacgacacggatcctggccacgctgacctggtcctc
tatatcacgaggtttgacctggagttgcctgatggtaaccggcaggtgcggggagtcacc
cagctgggtggtgcctgctccccaacctggagctgcctcattaccgaggacactggcttc
gacctgggagtcaccatcgcccatgagatcgggcacagcttcggcctggagcacgacggc
acgcctggcagcggctgcggccccagcggacacgtgatggcttcagacggcgccgcgccc
cgcgctggcctcgcctggtccccctgcagccgccggcagctgctgagcctgctcagcgca
ggacgggcgcgctgcgtgtgggaccccccgcggcctcagcctgggtccgcggggcgccag
ccggaggcgcagcctggcctctactacagcgccaacgagcagtgccgcgtggccttcggc
cccaaggcagtcgcctgcaccttctccagggagcacttggatatgtgccaggccctctcc
tgccacacagacccgctggaccaaagcagctgcagccgcctcctcgttcctctcctggac
gggacagaatgtggcatggagaagtggtgttccaagggtcgctgccgctccctggtggag
ctgacccccatagcagcggtacatgggcactggtctagctggggtccccaaagtccttgc
tcccgctcctgcggaggaggtgtggtcaccaggaggcggcagtgcaacaaccccagacct
gcctttggggggcgtgcgtgtgttggtgctgacctccaggccgagatgtgcaacactcag
gcctgtgagaagacccagctggagttcatgtcggaacagtgtgccaggaccgacaaccag
ccgctgcactcctcccctggcggtgcctccttctaccactggggcgctgctgtaccacac
agccaaggggatgctctgtgcaggcacatgtgccgggcagttggcgagagcttcatcatg
aagcgtggagacagcttcctggatgggacccggtgtgtgccaagtggcccccaggaggat
gggaccctaagcctgtgcgtgtcgggcagctgcaggacatttggctgtgatggcaggatg
gactcccagcaggtacgggacgtgtgccaggtatgtggtggggacaacagcacgtgcagc
ccacggaacggctctttcacagctggaagagcgagagaatatgtcacatttctgacggtt
acccccaacctgaccagtgtctacattgccaaccacaggcctctcttcacacacttggcg
gtgaggattggagggcgctacgttgtggctgggaagacgagcatctcctctaacaccacc
tacccctccctcctggaggatggccgtgtcgagtacagagtggccctcaccaaggaccgg
ctgccccacctggaggagatccgcatctggggacccctccaggaagatgctgagatccag
gtttacagacggtacggcgaggagtatggcaacctcacctgcccagacatcactttcacc
tacttccagcctaagccgcggcaggcctgggtgtgggccgctgtgcgtgggccctgctcg
gtgagctgtggggcagggctgcgctgggtaaactacagctgcctggaccaggccaggaag
gagttggtagagactgcccggtgccaagggagccagcagccaccagcgtggccagaggcc
tgcatgctcgaaccttgccctccgtactgggcggtgggagacttcggcccatgcagtgtc
tcctgtgggggtggcctgcgggagcggccagtgcgctgcgtggaggcccagggcagcctc
ctgaagacgttgcccccagcccggtgcacagcaggggcccagcagccagctgtggcagtg
gaaatctgcaacccccagccctgccccgccaggtgggaggtgtcagagcccggcccatgc
acatcagccagtggagcaggcccggccttgcagaacgagacctgtgtgccgggggcagat
ggcctggaggctccagcgactgaagggcctgactccgtagatgagaagctgcctgcccct
gagccgtgtgtcgggatgtcatgccctgcaggctggggccatctggatgccacctctgca
ggggaggaggctccctccccatggggcagcatcaggacgggggctcaagctgcacacgtg
tggacccctctggcagggccgtgctccgtctcctgcgggcgaggcctgatggagctgcgt
ttcctgtgcatggacgctgccctcagggtgcctgtccaggaggagctgtgtggcctggca
agcaagcctggaagccggcgggaggtctgccaggctgtcccgtgccctgctcggtggcag
tacaagctggcggcctgcagcgtgagctgtgggggaggggtcatgcggaggatcctgtat
tgtgcccgggcccatggggaggatgaggaggaggagatcctgttggacacccaatgccag
gggctgcctcgcccagacccccaggaggcctgcagcctggagccctgcccacctaggtgg
aaagtcatgtcccttggcccatgttcggccagctgtggccttggcactgctaggcgctcg
gtggcctgtgtgcagctcgaccaaggccaggacgtggaggtggacgaggcggcctgtgcg
gcactggtgcggccccaggccagcgtcccctgtctcattgctgactgcacctaccgctgg
tatgtcggcacctggacggagtgctctgtttcctgtggggatggcatccagcgccggcat
gacacctgcctcggaccccaggcccaggcgcctgtgccggttgatttctgccagcacttg
cccaagccagtgactgtgcgtggctgctgggctgggccctgtgtgggacaggggacgccc
aacctggtgcctcacgaagaagccactgctccaggacagaccacagccacccctgctggt
gcctccctggagtggtcccaggccccggccctgctcttctccccggctccccagcctcgg
cggctcctgcccgggccccaggaaagctcggcgcagtccagtgcctgtggcaggcagcac
cttgagccaacaggaaccattgacatgcgaggaccagggcaggcagactgtgcagtggcc
attgggcggcccctcggggaggtggtgaccctccgtgtccttgagagttctctcaactgc
agtgcgggggacatgttgttgctttggggccggctcacctggaggaagatgtgcaggaag
ctattgggcatgactttcagctccaagaccaacacgctggtggtgaggcagcgctgcagg
cagccgggagccggggtgctgctgcggtatgggagccagcttgctcctgaaaccttctac
agagaatgtgacatgcagctctttgggccctggggtgaaatcgtgagcccctcgctgagt
ccagccacgagtaaggcagggggctgccggctcttcattaacgtggctccgcacgcccgg
attgccatccatgccctggctaccaacatggacaatgggaccaagggagccaatgccagc
tacatctcgatccgggacatccacagcttgaggaccacaacgttccatgggcagcaggtg
ctctactgggagtcagagagcagccaggctgagatggagttcagcgaggacttccttaag
gctcaggccagcctgcggggccagtactggaccctccaatcatgggtaccggaggggcag
gaccctcagtcctggaagggaaaggaagggacctga

DBGET integrated database retrieval system