KEGG   Macaca mulatta (rhesus monkey): 722472Help
Entry
722472            CDS       T01028                                 

Gene name
LAMA1
Definition
(RefSeq) LOW QUALITY PROTEIN: laminin subunit alpha-1
  KO
K05637  laminin, alpha 1/2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc05145  Toxoplasmosis
mcc05146  Amoebiasis
mcc05165  Human papillomavirus infection
mcc05200  Pathways in cancer
mcc05222  Small cell lung cancer
mcc05410  Hypertrophic cardiomyopathy (HCM)
mcc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mcc05414  Dilated cardiomyopathy (DCM)
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    722472 (LAMA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    722472 (LAMA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    722472 (LAMA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    722472 (LAMA1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    722472 (LAMA1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    722472 (LAMA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    722472 (LAMA1)
   05414 Dilated cardiomyopathy (DCM)
    722472 (LAMA1)
   05416 Viral myocarditis
    722472 (LAMA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    722472 (LAMA1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    722472 (LAMA1)
   05145 Toxoplasmosis
    722472 (LAMA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_N Laminin_B Laminin_II Laminin_G_3 DUF1080
Motif
Other DBs
NCBI-GeneID: 722472
NCBI-ProteinID: XP_001118617
Ensembl: ENSMMUG00000011408
UniProt: F6VZB6
Position
18
AA seq 3079 aa AA seqDB search
MRGGGAWGVLLASLLWVAARCQQRGLFPAILNLASNADISTNATCGEKGPEMFCKLVEHV
PGRPVRNPQCRICDGNSVNPRERHPISHAIDGTNNWWQSPSIQNGREYHWVTITLDLRQV
FQVAYVIIKAANAPRPGNWILERSLDGTTFSPWQYYAVSDSECLSRYNITPRRGPPTYRA
DDEVICTSYYSRLVPLEHGEIHTSLINGRPSADDLSPKLLEFTSARYIRLRLQRIRTLNA
DLMTLSHREPKDLDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDETTKKLQCQCEHNT
CGESCNRCCPGYHQRPWRPGTVSSGNTCEACNCHNKAKDCYYDESVAKQKKSLNTAGQFR
GGGVCTNCLQNTMGINCETCIDGYYRPHKVSPYEDEPCRPCDCDPVGSLSSVCVKDDLHS
DLRNGKGPGQCPCKEGYAGEKCDRCQLGYKDYPACVSCGCNPVGSASDEPCTGPCVCKEN
VEGKACDRCKPGFYNLKEKNPQGCSECFCFGVSDVCSSLSWPVGQVSNMSGWLVTDLISP
RRIPSQQDALGGRHQVSINNTAVMQRLAPKYYWAAPEAYLGNKLTAFGGFLKYTVSYDIP
VETVDSNLMSHADVIIKGNRLTLSTQAEGLSLQPYEEYLNVVRLVPENFRDFHSKRQIDR
DQLMTVLANVTHLLIRANYNSAKMALYRLESVSLDVASSNAIGLAVAADVEHCECPQGYI
GTSCELCLSGYYRVDGILFGGICQPCECRGHAAECDVHGICIACAHNTTGDHCERCLPGF
YGEPSRGTPGDCQPCACPLTIASNNFSPTCHLNDGDEVVCDQCAPGYSGAWCERCADGYY
GNPTVPGESCVPCDCSGNVDPSEAGHCDSVTGECLKCLGNTDGAHCERCADGFYGDAVTA
KNCRACRCHAKGSHSAVCHLETGLCDCKPNVTGQQCDQCLHGYYGLDSGHGCRPCNCSVA
GSVSDDCTDEGQCHCVPGVAGKRCDRCARGFYAYQDGSCTPCDCPHTRNTCDPETGECVC
PPHTQGARCEECEDGHWGYDVEVGCQACNCSLVGSSHHQCDVVSGRCQCNWKFGGRACDQ
CSLGYRDFPDCVPCDCDLRGTSGDACNLEQGLCGCAEETGACPCKENVSGPQCNECREGS
FALRADNALGCSPCFCSGLSHLCSELEGYVRTPVTLGSDQPLLRVVSQSNLRGTTEGVYY
QAPDFLLDAATVRQHVHAEPFYWRLPRQFQGAQLMAYGGKLKYSVAFYSLDGVGTSNFEP
QVLIKGGRTRKQVIYMDTPAPENGVRQEQEVAMREHFWKYFNSVSEKPVTREDFMSVLSN
IEYILIKASYGQGLQQSRISDISMEVGRKAEKPHPEEEVASLLENCVCPPGTVGFSCQDC
APGYHRGKLPAGSGRGPRPLVAPCVPCSCNNHSDTCDPDTGKCLNCGDNTAGDHCDVCAF
GYYGKVTGSASDCALCVCPHSPPASFSPTCVLEGDHNFRCDACLLGYEGQHCERCSLGYY
GNPQTLGGSCQKCDCNLHGSVHGDCDRTSGQCVCRLGASGLRCDECEPRHILMETDCVSC
DDECVGVLLNDLDEIGGAILSLNLTGIIPVPYGILSNLENTTKYLQESLLRENMQKDLGR
IKLEGVAEETDNLQKKLTRMLASTQKVNRATERIFKESRDLAIAIERLRMNITEIIEKTT
LNQTLDEDFLLLNSTLQSMQQNGTSLLEIMQRRDFTQLHQNATLELKAAEDLLSQIQENY
QKPLEELEVLKEATSHLLSRHNSELQAAEVLVREAEAKTEESNHLLFMVNANLREFSDKK
LHVQEEQNLTSELIARGRGLIDTAAVQTDAVQDALEHLEHHQDTLLLWSARIRHHVDDLV
MHMSQRNALDLVYSAEDHAAEFQRLADVLDSGLENVRNVSLNATSAAYVHYNIQNLIEES
EELAKDAHRTVTEMSLLSESLVSNGKAAVQRSSRFLNEGDNLSRKLPVIALELSELRNKT
NRFQENADEITRQTNESVLILRAIPEDTRDKGAKTKELATSASHSAVSTLRDVAGLSQEL
LSTSASLSRVNATLQETHQLLQDSTMATLLAGRKVKDVETQANLLFDRLKPLKMLEENLS
RNLSEIKLLISQARKQAASIKVAVSADRDCIRAYQPQISSTNYNTLTLNVKTQEPDNLLF
YLGSSTSSDFLAVEMRRGKVAFLWDLGSGSTRLEFPDFPIDDSRWHSIHVARFGNIGSLS
VKEMSSNQKPPAKTSKSPGTANVLDVNNSTLMFVGGLGGQIKKSPAVKVTHFKGCLGEAF
LNGKSIGLWNYIEREGKCHGCFGSSQNEDASFHFDGSGYSVVEKSLPATVTQIIMLFNTF
SPNGLLLYLGSYGIRDFLSIELFHGRVKVTTDLGSGPLTLLTDRRYNNGTWYKIAFQRNR
KQGVLAVNDAYNTSNKETKQGETPGASSDLNRLDKDPIYVGGLPRSRVVRRGVTAKSFVG
CIKNLEISRSTFDLLRNSYGVRKGCSLEPIRSVSFLKGGYIELPPKSLSPESEWLVTFAT
KNSSGIILAALGGDAEKQRDREESHVPFFSIMLIGGNIEVHVNPGDGTGLRKALLHAPTG
TCSDGQAHSISLVRNRRIITVQLDENNRVEMKLGPLVESRTINMSNLYVGGIPEGEGTSL
LTTRRSFHGCIKDLIFNLELLDFNSAVGHEQVDLDTCWLSERPKPAPDAEDSELLPEPRA
FPEQCVVDAALEYVPGAHQFGLSQNSHFLLPFNQSAVRKRLSVELSIRTFASSGLIYYMA
HQNQADYAVLQLHGGRLHFMFDLGKGRTKVSHPALLSDGKWHTVKTDYVKRKGLITVDGQ
ESPMVTVVGDGTTLDVEGLFYLGGLPSQYRARKIGNITHSIPACIGDVTVNSKQLDKDSP
VSTFTVNRCYAAAQEGTFFDGSGYAALVKEGYKVQTDVNITLEFRTSSQNGVLLGISTAK
VDAIGLELVDGKVLFHVNNGAGRITATYEPKTATALCDGKWHTLQANKSKHRITLIVDGN
AVGAESPHTRSTSVDTNNPIYVGGYPAGVKQKCLSSQTSFRGCLRKLVLIKRPQVQSFDF
SRAFEWHGVFLHSCPGTES
NT seq 9240 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcggcggcgcgtggggcgtgctcctggcctcgctgctgtgggtcgccgcgcgg
tgccagcagagaggcctgtttcctgccattctcaatcttgccagcaacgctgacatcagt
accaatgccacctgtggcgagaaggggcccgagatgttctgcaaacttgtggagcatgtg
ccgggtcggcccgtccgaaacccacagtgccggatctgtgatggcaacagtgtgaacccc
agagaacgccatccaatatcacatgccatagatggcaccaataactggtggcaaagtccc
agcattcagaatgggagagagtatcactgggtcacaatcactctggacttaagacaggtc
tttcaagttgcatatgtcatcattaaagctgccaatgcccctcgacctggaaactggatt
ttggagcgttctctagacggcaccacgttcagcccctggcagtattatgcagtcagcgac
tcagagtgtttgtctcgttacaatataactccaagacgagggccgcccacctacagggct
gatgatgaagtgatctgcacctcctattattccagattggtgccacttgagcatggagag
attcatacatcactcatcaatggcagaccaagcgctgacgatctttcacccaagttgttg
gaattcacttctgcgcgatatattcgccttcgcttacagcgcattagaacgctcaatgca
gatctcatgacccttagccaccgggaacctaaagacctggatcctattgttaccagacgc
tattattattcaataaaggacatttctgttggaggcatgtgtatctgctatggtcatgct
agtagctgtccatgggatgaaactacaaagaaactgcagtgtcaatgtgagcataatact
tgcggggagagctgtaacaggtgctgtcctgggtaccatcagcggccctggaggcctgga
accgtgtcctctggcaatacatgtgaagcatgtaattgtcacaataaagccaaagactgt
tactatgatgaaagtgttgcaaagcagaagaagagtttgaatactgctggacagttcaga
ggaggaggggtttgcacaaactgcttgcagaacaccatgggaatcaactgtgagacctgt
attgatggatattatagaccacacaaagtgtctccttatgaggatgagccttgccgcccc
tgtgactgtgaccctgtggggtccctcagttctgtctgtgttaaggatgaccttcattct
gacttacgcaatgggaaggggccgggtcagtgcccatgtaaggaaggctatgcaggagaa
aaatgtgatcgctgccaacttggctataaggattacccagcctgtgtctcctgtgggtgc
aacccagtgggcagtgccagtgacgagccctgcacagggccctgtgtttgtaaggaaaat
gttgaggggaaagcctgcgatcgctgcaagccaggattctacaacctgaaggagaaaaac
ccccagggctgctccgagtgcttctgctttggcgtttccgatgtctgcagcagcctctct
tggcctgttggtcaggtaagcaatatgtcggggtggctggtcaccgacttgatcagtccc
aggaggattccgtctcagcaagatgcactgggtgggcgccaccaggtcagcatcaacaac
accgcggtcatgcagaggctggctcccaagtactactgggcggcccccgaggcctacctt
ggaaataagctgactgcatttggtggattcctgaaatacacggtgtcttacgatattcca
gtagagacggtagacagtaacctcatgtcgcacgctgatgtcatcattaagggaaacaga
ctcactttaagcacacaggctgagggtctgtcattgcagccttacgaagagtacctaaat
gtggttagacttgtgcccgaaaacttccgagattttcacagcaaaaggcagatcgatcgt
gaccagctgatgactgtccttgccaatgtgacacatcttttgatcagagccaactacaat
tctgcaaaaatggctctttacaggttggagtccgtctctctggacgtagccagctctaat
gccatcggcctggcagtggccgccgatgtggagcactgtgaatgtccacaaggctacata
gggacctcctgtgagttgtgcctctctggctattaccgcgtggatggaatactcttcgga
ggaatttgtcaaccctgtgaatgccgcggccacgcagctgagtgcgacgttcacggcatt
tgcattgcatgtgcgcacaacaccaccggcgaccactgcgagcggtgcttgcccggcttc
tacggggagccttcccgagggactcccggggactgccagccctgcgcctgccctctcacc
atagcctccaacaatttcagccccacctgccacctcaatgatggggatgaggtggtctgc
gaccagtgtgccccgggatactcaggagcttggtgtgagagatgtgcagatggttactat
ggaaacccaacagtgcctggcgaatcttgtgttccctgtgactgcagcggcaacgtggac
ccctcggaggctggtcactgtgactcggtcaccggggagtgcctgaagtgcctggggaac
acagacggcgcccactgtgaaaggtgtgctgacggcttctacggggacgctgtgacagcc
aagaactgccgcgcctgcagatgccatgcgaaaggctcccattctgccgtgtgccatctt
gagaccggactctgcgactgcaaaccaaacgtgactggacagcagtgtgaccagtgtttg
catggctattatgggctggactcaggccatggctgccggccctgcaactgcagcgtggca
ggctccgtgtcagatgactgcacggatgaaggccagtgtcactgcgtcccaggtgtggca
gggaaaaggtgtgacaggtgtgcccgtggcttctacgcctaccaggatggcagctgtaca
ccctgtgactgcccacacactcggaatacctgcgacccagaaactggagagtgtgtctgc
ccccctcacacacagggtgcgaggtgtgaagaatgtgaggatgggcactggggctatgat
gtggaggtggggtgccaggcctgcaactgcagtctcgtggggtcgtctcatcatcagtgt
gacgtggtcagcggccgttgccagtgcaactggaaatttggtggccgggcctgtgatcag
tgctccttgggttacagagactttcccgactgtgttccctgtgactgtgacctgaggggg
acgtcgggggatgcctgcaacctggagcagggtctctgcggctgtgcagaggaaaccggg
gcctgcccttgcaaggagaatgtgtctggccctcagtgcaacgagtgtcgagagggcagc
tttgctctccgcgcagacaacgccctgggctgcagcccctgcttctgctccgggctgtcc
cacctctgctcagagctggagggctacgtgaggaccccagtaacgctgggctccgatcag
cctcttctgcgtgtggtttctcagagtaacctgaggggcacgaccgagggggtttactac
caggcccccgacttcctgctggatgccgccaccgtccggcagcacgtccacgcagagccg
ttttactggcggctgccgcggcagttccagggagcccagctcatggcctatggtggcaaa
ctgaagtacagcgtggccttctattctttggacggcgtcggcacctccaattttgagcct
caagttctcatcaaaggtggtcggaccagaaagcaagtcatttacatggatacaccagca
ccagagaatggagtgaggcaggaacaagaagtagcaatgagagagcatttttggaaatat
tttaactccgtctcggaaaaacctgtcacgcgagaggattttatgtctgtccttagcaac
attgagtacatcctcatcaaggcatcatatggtcaaggattacagcagagcagaatctca
gacatttcaatggaggttggcagaaaggctgaaaagccgcacccagaagaagaggttgca
tctcttttagagaattgtgtctgtcctcctggcactgtgggattctcgtgtcaggactgt
gcccctgggtaccacagagggaagctcccagcagggagtggcaggggaccgcgccctctg
gttgctccttgtgtgccctgcagttgcaacaaccatagtgacacctgtgaccccgacacc
gggaagtgtctgaactgcggcgataacacagcaggtgaccattgcgatgtgtgtgctttt
ggctactatgggaaggtgactggctcagcaagtgactgtgctctgtgtgtctgtcctcac
agcccccccgccagttttagtcccacttgtgtcttggaaggtgaccacaatttccgttgt
gacgcctgtctcctgggctatgaaggacaacattgtgaaaggtgctccttgggctattat
gggaaccctcaaacactaggtggcagttgccagaagtgtgactgcaacctgcacggctct
gtccatggcgactgtgaccgcacatctgggcagtgcgtttgcaggctgggggcctcgggg
ctccggtgcgatgagtgtgaaccgaggcacattctgatggaaacggattgtgtttcctgt
gatgatgaatgtgtaggtgtgctgctgaatgacttggatgagattggtggtgccattctt
tctctgaacctcactggcattatccctgtcccatatggaattttgtcaaacctggaaaat
acaactaaatatctccaggaatctttattaagagaaaatatgcaaaaggacctgggaaga
attaagcttgaaggtgttgcagaagaaacggacaacctgcaaaagaagctcactagaatg
ttagcaagtacccaaaaggtgaacagggcaactgagagaatcttcaaggagagtcgagac
ctggccatagccattgagaggttgcggatgaacatcacagaaattattgaaaagaccact
ttaaatcagactttggatgaagatttcctgctactcaattctacacttcagagcatgcaa
cagaacgggacatctttgctggaaatcatgcagagaagagacttcacacagttgcaccaa
aatgccactcttgaactcaaggctgctgaagatttattgtcacaaattcaggaaaattac
caaaagccgctggaagaattggaggtattaaaagaagcaacaagccacctcctttcaagg
cacaacagtgaactacaggcggctgaggtgcttgtgagggaagccgaggcaaagaccgag
gaaagcaaccacctgctgttcatggtcaatgctaacctgagagaattcagtgataaaaag
ctacatgttcaagaagaacaaaatctgacctcagagctcattgcccgaggacgaggactg
atagatactgccgctgtgcaaacagatgctgtgcaagatgctctagagcacttagagcat
caccaggatacgctacttttatggtctgccagaatcaggcaccacgtagatgacctggtc
atgcacatgtcccaaaggaacgcgcttgacctggtctacagcgctgaggaccatgccgct
gagttccagagactggcagacgttctggacagtggccttgaaaatgtcagaaatgtgtcc
ctgaatgccaccagtgcagcctatgtccattacaacatccagaacctgatcgaagaatcg
gaggaactggccaaagatgctcacaggactgtgactgagatgagcctgctctcagaatcc
cttgtttctaatgggaaagcggccgtgcagcgcagctccagatttctaaatgaaggcgac
aacctcagcaggaagcttccagttattgcattggaactgagtgaactgagaaataagaca
aacagatttcaagagaatgctgatgaaattaccaggcagaccaatgaatcagtcttgata
ctcagagcaattcctgaagatacaagagacaaaggagccaaaaccaaagagctggccacg
tctgcaagccatagcgcggtgagcacgctgagggacgtggcagggctgagccaggagctg
ctgagcacatctgccagcctgtccagggtcaacgccacattacaagagacacaccagctt
ctgcaggactccaccatggccactctgttggctggaaggaaagtcaaagacgtggaaact
caagccaaccttttgtttgatcggttgaagcctttgaagatgttagaagagaatctgagc
agaaacttatcagaaattaaactgctcatcagccaggcccggaaacaagcagcttctatt
aaagtcgccgtgtctgcagacagagattgcatccgggcctaccagcctcagatttcctct
actaactacaacaccttaacactaaatgttaagacacaggaacccgacaatcttctcttc
tacctcggtagcagcacctcttctgatttccttgcagtggagatgcggcgagggaaagtg
gccttcctgtgggacctgggctccggctccacacgcttggagtttccagactttcccatt
gatgacagcagatggcacagtatccatgtggccagatttggaaacattggttcactgagt
gtaaaggaaatgagctcaaatcaaaagccaccagcaaaaacaagtaaatcccctgggaca
gctaatgttctggatgtaaacaattcaacactcatgtttgttggaggtcttggaggacaa
atcaagaaatctcctgctgtgaaggttactcattttaaaggctgcttgggagaggccttc
ctgaatggaaaatccatcggcctatggaactatatcgaaagggaaggcaagtgccacggg
tgctttggaagctcccagaatgaagacgcttccttccattttgacgggagtgggtactct
gtcgtggagaagtcacttccggctaccgtgacccagataatcatgctttttaataccttt
tcacctaatggacttcttctctacctgggttcatacggcataagagactttttatccatc
gagctgttccatggcagagtgaaggttacgacagacctgggttcaggaccccttaccctt
ttgacagacagacgttataacaatggaacctggtacaaaattgccttccagcgaaaccgg
aagcaaggagtcctagcagttaacgatgcctataacaccagtaataaagaaaccaagcag
ggcgagactccgggagcgtcttccgacctcaaccgtctagacaaggatccgatttatgtg
ggtggattaccaaggtcaagagttgtaaggagaggtgtcaccgccaaaagctttgtgggc
tgcatcaagaacctggaaatatccagatcaacctttgacttactccgaaattcctatgga
gtgagaaaaggctgctcactggagcccatccggagtgttagcttcttgaaaggcggctac
attgaattgccacccaagtctttgtcaccagaatcggaatggctggtaacatttgccacc
aagaacagcagtggcatcatcctggctgccctcggcggggatgcggagaagcagcgcgat
cgtgaggagtcacacgtgcccttcttttccatcatgctgattggaggcaacatcgaggta
catgtcaatcctggggatggcacaggcctgagaaaagctctcctgcacgctcccacgggt
acatgcagcgacggacaagcacattccatctccttggtcaggaatcggagaattatcact
gtccaattggatgagaacaatcgtgtggaaatgaagttgggcccattagtagaaagcagg
acgataaatatgtccaatctgtacgtcgggggaattccagagggagaggggacatcgctg
ctcacaacgagaagatcgttccatggctgtatcaaagacctgatctttaatttggaactt
ttggatttcaacagcgcagttggccatgagcaagtcgacttggacacctgctggctgtca
gaaaggcctaagccggctcccgatgcagaggacagcgagctcttgccagagccccgggct
tttccagaacagtgtgtggtggatgcagctctggagtacgttcccggcgcccaccagttt
ggtctctcacaaaacagccatttcctgttgccttttaaccagtcggctgtcagaaagagg
ctctcggttgagctaagtatccgcacgttcgcctccagcggcctgatttactacatggct
catcagaaccaagcagactacgccgtgctccagctgcacgggggccgcctccacttcatg
tttgacctcggcaaaggcagaacaaaggtctctcaccctgcactgctcagcgatggcaag
tggcacacggtcaagacagactatgttaaaagaaaaggcctcataacggttgacggccaa
gagtcccccatggtgaccgtggtgggagacggaaccacgctggatgtggagggtttgttc
tacctaggaggcctgccctcccagtaccgggccaggaaaattggaaatatcacccacagc
atccctgcctgcattggggatgtgacggttaacagcaaacagctggacaaggacagcccg
gtgtccaccttcacggtgaacaggtgctacgcagcggcccaggagggaacgttctttgat
ggaagcggatacgcagctcttgtcaaagagggctacaaagtccagacagatgtgaacatc
acactggagtttcgaacctcctcgcagaatggcgtcctcctggggatcagcactgccaaa
gtggatgccattggactagagcttgtggacggcaaggtcttgttccatgtcaacaatggt
gctggcaggataacagccacgtatgagcccaaaaccgccactgcgctctgtgatggaaaa
tggcacacgcttcaagctaacaaaagcaaacaccgtatcactctgattgtcgatgggaat
gcagttggcgctgaaagtccacacacccggtctacctcggtggacaccaacaatcccatt
tatgttggtggctatcctgctggcgtgaagcaaaaatgcctgagcagccagacctcgttc
cgcgggtgtttgaggaagctagtgctgattaagaggccgcaggtgcaatcctttgacttc
agcagagcgtttgaatggcatggagttttccttcattcctgtcctgggacggagtcctga

DBGET integrated database retrieval system