KEGG   Mycoplasma crocodyli: MCRO_0412Help
Entry
MCRO_0412         CDS       T01205                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mcd  Mycoplasma crocodyli
Pathway
mcd00010  Glycolysis / Gluconeogenesis
mcd00020  Citrate cycle (TCA cycle)
mcd00620  Pyruvate metabolism
mcd01100  Metabolic pathways
mcd01110  Biosynthesis of secondary metabolites
mcd01120  Microbial metabolism in diverse environments
mcd01130  Biosynthesis of antibiotics
mcd01200  Carbon metabolism
Module
mcd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mcd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCRO_0412 (pdhC)
   00020 Citrate cycle (TCA cycle)
    MCRO_0412 (pdhC)
   00620 Pyruvate metabolism
    MCRO_0412 (pdhC)
Enzymes [BR:mcd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MCRO_0412 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding CBFD_NFYB_HMF
Motif
Other DBs
NCBI-ProteinID: ADE19953
UniProt: D5E5K1
Position
485662..486597
Genome map
AA seq 311 aa AA seqDB search
MMKIKSTPIARALAAKLGVDIEQVKGSGIDGRILLEDVQNFKNNPTSTPVQNQKIEASAN
VEAAKSAPTVAPSKPVFITEPHSEPIAPIRKAIAKAMTNSWSNVAYTNLVHEINMTRLWN
LRSSIKDIVLKNENVKLTFLPYIVKAIAIALKEFPKFSAKYNEANSTLDYPGVINVGVAV
DTEAGLMVPVIKNAATLSILEIASEVSRLAGAARKRTIKPDEMKGAGFTVTNYGSVGSLF
GVPVINYPELAIAGVGAIIDRPIVENGAVVPGKVMYITVAADHRWIDGAEVGRFASRVKE
LLETPEVLGVY
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaattaaaagtacaccaattgctcgtgctcttgctgctaaattaggagtagat
atcgaacaagttaaaggaagcggaattgatggaagaattttattagaagatgttcaaaat
tttaaaaacaatccaacatcaactcctgtccaaaatcaaaaaattgaagcaagcgctaat
gttgaagctgctaaatcagctccaaccgttgctccaagtaaaccagtttttataactgaa
cctcatagcgaaccaattgctcctatcagaaaagcaatcgctaaagcaatgacaaattca
tgaagtaatgtagcttatacaaacttggttcatgaaattaatatgactagattatgaaat
ctacgttcatcaattaaagacatagtgctaaaaaatgaaaacgttaagttaacattctta
ccatatatagtaaaagcaatcgctattgcacttaaagaattccctaaatttagtgcaaaa
tacaatgaagcaaatagcacattagattatcctggtgtaatcaatgttggagttgctgtt
gatacagaagcaggattaatggttcctgtaattaaaaatgctgcaacattaagcatttta
gaaattgcaagtgaagtatctagattagcaggtgctgctagaaaaagaacaatcaaaccc
gatgaaatgaagggtgcaggatttaccgtaactaactatggttcagttggatcattgttt
ggagtaccggtaattaattatccagaattagctattgctggagttggtgctattattgat
agaccaattgtagaaaatggagcagttgtgccaggaaaagtaatgtatataactgtcgca
gctgaccacagatgaatagacggtgcagaagttggaagatttgcttctagagtaaaagaa
ctacttgaaacacctgaagtattaggagtatattaa

DBGET integrated database retrieval system