KEGG   Mycoplasma crocodyli: MCRO_0483Help
Entry
MCRO_0483         CDS       T01205                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mcd  Mycoplasma crocodyli
Pathway
mcd00010  Glycolysis / Gluconeogenesis
mcd00030  Pentose phosphate pathway
mcd00051  Fructose and mannose metabolism
mcd00052  Galactose metabolism
mcd00680  Methane metabolism
mcd01100  Metabolic pathways
mcd01110  Biosynthesis of secondary metabolites
mcd01120  Microbial metabolism in diverse environments
mcd01130  Biosynthesis of antibiotics
mcd01200  Carbon metabolism
mcd01230  Biosynthesis of amino acids
mcd03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mcd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCRO_0483 (pfkA)
   00030 Pentose phosphate pathway
    MCRO_0483 (pfkA)
   00051 Fructose and mannose metabolism
    MCRO_0483 (pfkA)
   00052 Galactose metabolism
    MCRO_0483 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MCRO_0483 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MCRO_0483 (pfkA)
Enzymes [BR:mcd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MCRO_0483 (pfkA)
Protein phosphatases and associated proteins [BR:mcd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MCRO_0483 (pfkA)
Messenger RNA biogenesis [BR:mcd03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MCRO_0483 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADE19636
UniProt: D5E5R5
Position
complement(574169..575146)
Genome map
AA seq 325 aa AA seqDB search
MKKIAILTSGGDAPGMNPALCAIIRCAKSNGLTPYIVYEGFKGLYENNIKLTDDLDLDHV
QSQGGTAIYSARFPEFKNEEVRNVAIENLMKKGIDSLIVIGGDGSYMGAQLLHEKGFKTI
GIPGTIDNDIASSDYTIGYDTALNTIVDSIDKIRDTATSHKRIMIVEVMGNECGDLALYS
GLATGAEIIATSDHVISIPDMANLAYELTLQEKRRSVIIIVSEKRYDLKYLEKAIEEKTK
WTTRATSLAHVQRGGRPTAQERILSSLFGIKAVELILEGKSGLAIGVINNDIVGTPILEA
LSMVNKAKEKARVKLQKYNKLNKIL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagcgattttaacttcaggtggagatgcaccaggaatgaaccctgcttta
tgcgcaattattagatgtgcaaaaagtaatggattaactccttatattgtttatgaaggt
tttaaagggttgtatgagaataatattaaattaacagatgatctagatttagaccacgtt
caatcacaaggtggaacagctatctattcagctcgttttccagaatttaagaatgaagaa
gtaagaaatgtagccatagaaaatctaatgaaaaaaggtattgattcactaatagtaatt
ggtggagatggaagttatatgggtgctcaattgttgcatgaaaaaggtttcaaaacaatt
ggaattcctggaacaattgataacgatatagcatcaagtgattatactataggatatgat
acagcacttaatacaatcgttgattctattgacaaaattagagatacagcaacttcacat
aaaagaattatgattgttgaagtaatggggaatgaatgtggtgatttagctctttatagt
ggtctagcaactggtgctgaaattatagcaacaagtgaccatgttatttcaattcctgat
atggcaaatctagcttatgaattaaccttacaagaaaaaagaagaagtgttattatcatt
gtttcagaaaagagatatgacttaaaatatcttgaaaaagcaattgaagaaaaaacaaaa
tgaactacaagagcaacttctttggcccatgttcaaagaggtggaagaccaactgcacaa
gaaagaatcctttcatcgttatttggtataaaagcagttgaattaattcttgaaggtaaa
tcgggtttagctataggagtaattaataatgatattgttgggacaccaatacttgaagcg
ttaagcatggttaataaagcaaaagaaaaagcaagagtaaaacttcaaaaatataataaa
ttaaataaaattttataa

DBGET integrated database retrieval system