KEGG   Mycobacterium canettii CIPT 140010059: MCAN_02671Help
Entry
MCAN_02671        CDS       T01585                                 

Definition
(GenBank) putative transcriptional regulatory protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
mce00860  Porphyrin and chlorophyll metabolism
mce01100  Metabolic pathways
mce01110  Biosynthesis of secondary metabolites
mce01120  Microbial metabolism in diverse environments
Module
mce_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MCAN_02671
Enzymes [BR:mce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MCAN_02671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: CCC42607
UniProt: G0TN60
Position
complement(318273..319418)
Genome map
AA seq 381 aa AA seqDB search
MAQAHSAPLTGYRIAVTSARRAEELCALLRRQGAEVCSAPAIKMIALPDDDELQNNTEAL
IADPPDILVAHTGIGFRGWLAAAEGWGLANELLESLSSARIISRGPKATGALRAAGLREE
WSPDSESSHEVLEYLLESGVSSTRIAVQLHGAADSWDPFPEFLGGLRFAGAQVVPIRVYR
WKPAPLGGVFDQLVTGIARRQFDAVTFTSAPAAAAVLERSRELDIEDQLLAALRTDVHAM
CVGPVTSRPLIRKGVPTSAPERMRLGALARHIAEELPLLGSCTFKAAGHVIEIRGTSVLV
DDSVKPLSPSGMAILRALVHRPGGVVSRGDLLRVLPGDGSDTHAVDTAVLRLRTALGDKN
IVATVVKRGYRLAVDSRHDDV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggcacactcggcgccactgaccggctaccggatcgcggtgacatccgctcgc
cgcgccgaagagctgtgcgcattgcttcgccgccagggcgccgaggtctgtagtgcccca
gcgatcaagatgatcgcgcttcccgacgacgatgaactgcagaacaacaccgaggcgttg
atcgccgacccgcctgacattctggtcgcccacaccggcatcggatttcgcggctggttg
gccgcggccgaggggtgggggctggccaacgagctcctggaatcgttgtcgtcggcccgg
atcatctcccgcggaccaaaggcaactggtgcgctgcgtgccgccggcctgcgtgaagag
tggtcccccgactctgaatcgtcgcatgaggtgctggaatatctgctcgaatcgggggtg
tccagtacgcgtattgccgtccagctgcacggtgccgccgacagctgggacccgtttccg
gaatttctgggcgggttacgtttcgccggcgcgcaagtggtgccgatccgggtttaccgg
tggaagccggcgccactaggcggcgtgttcgaccagttagtcaccgggatcgcgcgacga
caattcgacgcggtcaccttcacgtcggcacctgccgcggccgcggtgctagaacgcagc
cgtgaattggatatcgaggaccaactgttggctgcgctgcgtaccgatgtgcacgcgatg
tgtgtcggcccggtaacttcgcggccgttgatccgaaagggcgtcccgacgtcggctccc
gagcgaatgcggttgggagccttagcccgccacattgccgaggagctgccgctgctgggt
tcgtgcacgttcaaagcagccggccacgtgatcgagatccgtggaacctctgtgctggtg
gatgattcggtgaagccactatcgccgtccggaatggcgattttgcgcgcgttggtacat
cgccccggcggcgtcgtctctcgtggcgacttgctacgcgtcctacccggcgacggcagc
gacacccacgccgtggacaccgccgtactgcggctacgaacggctctgggcgacaagaac
atcgtggcaacagtggtgaaacgtggctaccgtctcgccgttgacagccggcacgatgac
gtatga

DBGET integrated database retrieval system