KEGG   Mycobacterium canettii CIPT 140010059: MCAN_07111Help
Entry
MCAN_07111        CDS       T01585                                 

Gene name
rplV
Definition
(GenBank) putative 50S ribosomal protein L22 RPLV
  KO
K02890  large subunit ribosomal protein L22
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
mce03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MCAN_07111 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mce03011]
    MCAN_07111 (rplV)
Ribosome [BR:mce03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MCAN_07111 (rplV)
  Bacteria
    MCAN_07111 (rplV)
  Archaea
    MCAN_07111 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF3629
Motif
Other DBs
NCBI-ProteinID: CCC43051
UniProt: G0TQJ1
Position
818848..819441
Genome map
AA seq 197 aa AA seqDB search
MTAATKATEYPSAVAKARFVRVSPRKARRVIDLVRGRSVSDALDILRWAPQAASGPVAKV
IASAAANAQNNGGLDPATLVVATVYADEGPTAKRIRPRAQGRAFRIRRRTSHITVVVESR
PAKDQRSAKSSRARRTEASKAASKVGATAPAKKAAAKAPAKKAPASSGVKKTPAKKAPAK
KAPAKASEASAAKGGSD
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgactgcggctactaaggctaccgagtatccctcggcggtcgccaaggcccgatttgtg
cgggtgtcgccaagaaaggcgcgccgggtgatcgatctggtgcgtggcaggtcggtgtca
gacgcgctcgacatcctgcgctgggcgccgcaggccgccagcggtccggtggccaaagtg
atcgccagtgcggcggccaacgcgcaaaacaacggcgggctggacccggcaaccttggtg
gtggccaccgtgtacgccgacgagggaccgaccgccaagcgcatccgtccgcgcgcccag
ggccgcgcgttccgcatccgccggcgcactagccacatcacggtggtggtggaaagccgg
ccggccaaagatcaacggtcggcgaaatcgtcgcgggcccgccgcaccgaggccagcaag
gccgccagcaaggtcggggctacggcgccggccaagaaagcggccgccaaagcgcccgcc
aagaaggcacccgccagttccggcgttaagaagacacccgcaaagaaagcgcccgccaag
aaggcacccgccaaggcttctgaggcttctgcagcgaagggaggctcagactag

DBGET integrated database retrieval system