KEGG   Mycobacterium canettii CIPT 140010059: MCAN_10121Help
Entry
MCAN_10121        CDS       T01585                                 

Gene name
metS
Definition
(GenBank) putative methionyl-tRNA synthetase METS (MetRS) (methionine--tRNA ligase)
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
mce00450  Selenocompound metabolism
mce00970  Aminoacyl-tRNA biosynthesis
mce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mce00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MCAN_10121 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MCAN_10121 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mce01007]
    MCAN_10121 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mce03016]
    MCAN_10121 (metS)
Enzymes [BR:mce01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MCAN_10121 (metS)
Amino acid related enzymes [BR:mce01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MCAN_10121 (metS)
Transfer RNA biogenesis [BR:mce03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MCAN_10121 (metS)
 Prokaryotic type
   Other AARSs
    MCAN_10121 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: CCC43349
UniProt: G0TGB9
Position
complement(1136259..1137818)
Genome map
AA seq 519 aa AA seqDB search
MKPYYVTTAIAYPNAAPHVGHAYEYIATDAIARFKRLDGYDVRFLTGTDEHGLKVAQAAA
AAGVPTAALARRNSDVFQRMQEALNISFDRFIRTTDADHHEASKELWRRMSAAGDIYLDN
YSGWYSVRDERFFVESETQLVDGTRLTVETGTPVTWTEEQTYFFRLSAYTDKLLAHYHAN
PDFIAPETRRNEVISFVSGGLDDLSISRTSFDWGVQVPEHPDHVMYVWVDALTNYLTGAG
FPDTDSELFRRYWPADLHMIGKDIIRFHAVYWPAFLMSAGIELPRRIFAHGFLHNRGEKM
SKSVGNIVDPVALAEALGVDQVRYFLLREVPFGQDGSYSDEAIVTRINTDLANELGNLAQ
RSLSMVAKNLDGRVPNPGEFADADAALLATADGLLERVRGHFDAQAMHLALEAIWLMLGD
ANKYFSVQQPWVLRKSESEADQARFRTTLYVTCEVVRIAALLIQPVMPESAGKILDLLGQ
APNQRSFAAVGVRLTPGTALPPPTGVFPRYQPPQPPEGK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgaagccctattacgtcaccaccgcgatcgcatatccaaacgctgcaccccacgtaggt
cacgcctacgaatacatcgccaccgacgcgatcgcccggttcaaacggctggacggctat
gacgtgcgcttcctgaccgggaccgacgagcatggcctgaaggtcgcacaagccgccgcg
gcagcgggcgtgcccaccgcggcgcttgcccggcgcaattccgacgtgtttcagcgcatg
caggaggcgctgaacatctccttcgaccgattcatccgcactaccgatgccgaccaccac
gaggcgtccaaggaactctggcgacggatgtcggcggccggcgacatctatctggacaac
tattccgggtggtactcggtgcgcgacgagcggttcttcgtcgaatcggagacccaactt
gtcgacggcacgcgcctgacggtagagaccggcacgccggtgacctggaccgaggagcag
acctacttcttccggctgtcggcctataccgacaagctgctggcccactatcacgccaac
cccgacttcatcgcgccggagacgcggcgcaacgaagtgatcagcttcgtctccggcggc
ctggacgacctgtcgatctcgcgcacctcgtttgactggggtgtgcaggtgcccgagcac
cccgaccacgtcatgtacgtctgggtcgacgcgctgaccaattacctgaccggggcgggc
ttcccggataccgactcggagttgttccgccgctactggcccgccgatttgcacatgatc
ggcaaggacatcatcaggtttcatgccgtctattggccggcgtttttgatgtcagccgga
atcgagttgccgcgaaggatcttcgcgcacgggttcttgcacaaccgcggcgagaagatg
agtaaatcggtgggcaacatcgtcgacccggttgccctggcggaagcgctcggggtggac
caggtccgctacttcctgttgcgggaggtcccgttcggccaggacggcagttacagcgac
gaggccatcgtcactcggatcaacaccgatctggccaacgagctcggcaacttggcccaa
cgctcgttgtcgatggtggccaaaaaccttgacggcagggtgcccaacccgggtgagttc
gccgacgccgacgccgcgctgcttgcgaccgccgatggcttgttggagcgagtgcgcggt
cacttcgacgcacaggcgatgcacctggcgctggaggcgatctggctgatgctcggcgac
gcgaacaagtacttttcggtgcagcagccgtgggtactgcgcaagagcgagtccgaagcc
gatcaggcccggttccgcaccacgctctacgtcacctgcgaggtagtccgcatcgcggca
ctgctgatccagccggtgatgccggagtcggccggcaaaattttggacctgctcggccag
gccccaaaccagcggtcgttcgccgccgtaggtgttcggctgacccccggcacagcgctg
ccgccgcccaccggggtatttccccgctaccagccgccgcaaccacccgaaggcaagtga

DBGET integrated database retrieval system