KEGG   Mycobacterium canettii CIPT 140010059: MCAN_11461Help
Entry
MCAN_11461        CDS       T01585                                 

Definition
(GenBank) putative acetyl-CoA acetyltransferase (acetoacetyl-CoA thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
mce00071  Fatty acid degradation
mce00072  Synthesis and degradation of ketone bodies
mce00280  Valine, leucine and isoleucine degradation
mce00310  Lysine degradation
mce00362  Benzoate degradation
mce00380  Tryptophan metabolism
mce00620  Pyruvate metabolism
mce00630  Glyoxylate and dicarboxylate metabolism
mce00640  Propanoate metabolism
mce00650  Butanoate metabolism
mce00900  Terpenoid backbone biosynthesis
mce01100  Metabolic pathways
mce01110  Biosynthesis of secondary metabolites
mce01120  Microbial metabolism in diverse environments
mce01130  Biosynthesis of antibiotics
mce01200  Carbon metabolism
mce01212  Fatty acid metabolism
mce02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MCAN_11461
   00630 Glyoxylate and dicarboxylate metabolism
    MCAN_11461
   00640 Propanoate metabolism
    MCAN_11461
   00650 Butanoate metabolism
    MCAN_11461
  Lipid metabolism
   00071 Fatty acid degradation
    MCAN_11461
   00072 Synthesis and degradation of ketone bodies
    MCAN_11461
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCAN_11461
   00310 Lysine degradation
    MCAN_11461
   00380 Tryptophan metabolism
    MCAN_11461
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MCAN_11461
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCAN_11461
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MCAN_11461
Enzymes [BR:mce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MCAN_11461
Exosome [BR:mce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MCAN_11461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C PGAP1
Motif
Other DBs
NCBI-ProteinID: CCC43482
UniProt: G0TH29
Position
1284081..>1284323
Genome map
AA seq 81 aa AA seqDB search
MQLGNQNTMRFAGRPQRFRQSAYPLFNPNSAIALGHPFGGSAARLMTTVLHHMPDKGIRY
GLQTMCEGRGQAKCRHCGVAV
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttggcaatcaaaacactatgagattcgcagggcggcctcagcgttttcgccaa
agcgcttaccccctgttcaaccccaacagcgcgatcgcgcttggccacccattcggcggc
tcggcggcacggttgatgactacagtgctacaccacatgccggacaagggaattcgctac
ggcttacagacgatgtgcgagggccgcggccaagccaaatgccgccattgtggagttgct
gtg

DBGET integrated database retrieval system