KEGG   Mycobacterium canettii CIPT 140010059: MCAN_16201Help
Entry
MCAN_16201        CDS       T01585                                 

Gene name
trpB
Definition
(GenBank) putative tryptophan synthase, beta subunit trpB
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
mce00260  Glycine, serine and threonine metabolism
mce00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mce01100  Metabolic pathways
mce01110  Biosynthesis of secondary metabolites
mce01130  Biosynthesis of antibiotics
mce01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCAN_16201 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MCAN_16201 (trpB)
Enzymes [BR:mce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MCAN_16201 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Gmad2
Motif
Other DBs
NCBI-ProteinID: CCC43952
UniProt: G0TJW2
Position
1837885..1839117
Genome map
AA seq 410 aa AA seqDB search
MSAAIAEPTSHDPDSGGHFGGPSGWGGRYVPEALMAVIEEVTAAYQKERVSQDFLDDLDR
LQANYAGRPSPLYEATRLSQHAGSARIFLKREDLNHTGSHKINNVLGQALLARRMGKTRV
IAETGAGQHGVATATACALLGLDCVIYMGGIDTARQALNVARMRLLGAEVVAVQTGSKTL
KDAINEAFRDWVANADNTYYCFGTAAGPHPFPTMVRDFQRIIGMEARVQIQGQAGRLPDA
VVACVGGGSNAIGIFHAFLDDPGVRLVGFEAAGDGVETGRHAATFTAGSPGAFHGSFSYL
LQDEDGQTIESHSISAGLDYPGVGPEHAWLKEAGRVDYRPITDSEAMDAFGLLCRMEGII
PAIESAHAVAGALKLGVELGRGAVIVVNLSGRGDKDVETAAKWFGLLGND
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccgccatcgccgaaccgaccagccacgatcctgattccggcggccatttcggc
ggccccagtggttggggtggccgctacgttcccgaggcgctgatggcggtgatcgaagag
gtcaccgccgcctaccaaaaggagcgcgtcagccaggactttctggacgacctggacagg
ctgcaggcgaactatgcgggccggccttcgccgctttacgaggcgacccggttgagccag
cacgctgggtcggcgcgaatctttctgaagcgagaagacctgaaccacactggttctcac
aagatcaacaacgtgctcgggcaggcactgctggcgcgcaggatgggcaagacccgggtg
atcgccgagaccggtgccggccagcacggggtcgccacggccaccgcatgcgcgttgctc
ggcctggactgtgtcatctacatggggggcatcgacaccgcccgtcaggcgctaaacgtg
gcccggatgcgattgctgggtgccgaagtcgtcgcggttcagacgggctcgaaaacgctc
aaagacgccatcaatgaggcgttccgggattgggttgccaacgccgacaacacctactac
tgctttggtacggcggccggaccgcatccgtttccaaccatggtgcgcgatttccagcga
atcatcggcatggaggcacgcgtgcagatccagggtcaggccggtcggctgcctgacgcc
gtcgttgcgtgcgttggtggcgggtccaatgccattggtatttttcatgcgtttcttgat
gacccaggcgtacggctggtcggattcgaggcagccggcgacggcgttgagaccggccgg
catgctgcgacattcaccgctggttcgcccggggcatttcacggatcgttctcgtacttg
ctgcaagacgaggacggtcagaccattgaatcccattcaatctccgcgggtctggattat
ccgggggtgggcccagaacacgcgtggctcaaggaggccgggcgtgtcgattatcggccg
atcaccgactccgaggcgatggacgcgtttggcctactgtgtcgcatggaaggcatcatc
cctgccattgaatccgcgcacgcggtagccggcgccctcaagctaggtgttgagttggga
aggggcgcggtgattgtggtgaacctgtcgggacgtggcgacaaagatgtcgagacggcc
gcgaaatggtttggcttgctgggcaacgactga

DBGET integrated database retrieval system