KEGG   Mycobacterium canettii CIPT 140010059: MCAN_18521Help
Entry
MCAN_18521        CDS       T01585                                 

Gene name
glcB
Definition
(GenBank) putative malate synthase G GLCB
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
mce00620  Pyruvate metabolism
mce00630  Glyoxylate and dicarboxylate metabolism
mce01100  Metabolic pathways
mce01110  Biosynthesis of secondary metabolites
mce01120  Microbial metabolism in diverse environments
mce01200  Carbon metabolism
Module
mce_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MCAN_18521 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    MCAN_18521 (glcB)
Enzymes [BR:mce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MCAN_18521 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: CCC44184
UniProt: G0TLA0
Position
complement(2123305..2125500)
Genome map
AA seq 731 aa AA seqDB search
MTDRVSVGNLRIARVLYDFVNNEALPGTDIDPDSFWAGVDKVVADLTPQNQALLNTRDEL
QAQIDKWHRHRVIEPIDMDAYRQFLTEIGYLLPEPDDFTITTSGVDAEITTTAGPQLVVP
VLNARFALNAANARWGSLYDALYGTDVIPETDGAEKGPTYNKVRGDKVIAYARKFLDDSV
PLSSGSFGDATGFTVQDGQLVVALPDKSTGLANPGQFAGYTGAAESPTSVLLINHGLHIE
ILIDPESQVGTTDRAGVKDVILESAITTIMDFEDSVAAVDAADKVLGYRNWLGLNKGDLA
AAVDKDGTAFLRVLNRDRNYTAPGGGQFTLPGRSLMFVRNVGHLMTNGAIVDTDGSEVFE
GIMDALFTGLIAIHGLKASDVNGPLINSRTGSIYIVKPKMHGPAEVAFTCELFSRVEDVL
GLPQNTMKIGIMDEERRTTVNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAGPMVRK
GTMKSQPWILAYEDHNVDAGLAAGFSGRAQVGKGMWTMTELMADMVETKIAQPRAGASTA
WVPSPTAATLHALHYHQVDVAAVQQGLAGKRRATIEQLLTIPLAKELAWAPDEIREEVDN
NCQSILGYVVRWVDQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGVITSADVRA
SLERMAPLVDRQNAGDVAYRPMAPNFDDSIAFLAAQELILSGAQQPNGYTEPILHRRRRE
FKARAGDDAAR
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcgcgtgtcggtgggcaacttgcgcatcgctcgggtgctctacgacttcgtg
aacaatgaagccctgcctggcaccgatatcgacccggacagcttctgggcgggcgtcgac
aaggtcgtcgccgatctgaccccgcagaaccaagctctgttgaacacccgcgacgagctg
caggcgcagatcgacaagtggcaccggcatcgggtgatcgagcccatcgatatggatgcc
taccgccagttcctcaccgagatcggctacctgcttcccgaacctgatgacttcaccatc
accacgtccggtgtcgacgccgagatcaccacgaccgccggcccccagctggtggtgccg
gtgctcaacgcgcggtttgctctgaacgcggccaacgctcgctggggctccctctacgac
gccttgtacggcaccgatgtcatccccgagaccgacggcgccgaaaaaggccccacgtac
aacaaggttcgtggcgacaaggtgatcgcgtatgcccgcaagttcctcgacgacagtgtt
ccgctgtcgtcgggttcctttggcgacgccaccggtttcacagtgcaggatggccagctc
gtggttgccttgccggataagtccaccggcctggccaaccccggccagttcgccggctac
accggcgcagccgagtcgccgacatcggtgctgctaatcaatcacggtttgcacatcgag
atcctgatcgatccggagtcgcaggtcggcaccaccgaccgggccggcgtcaaggacgtg
atcctggaatccgcgatcaccacgatcatggacttcgaggactcggtggccgccgtggac
gccgccgacaaggtgctgggttatcggaactggctcggcctgaacaagggcgacctggca
gcagcggtagacaaggacggcaccgctttcctgcgggtgctcaatagggaccggaactac
accgcacccggcggtggccagttcacgctgcccggacgcagcctcatgttcgtccgcaac
gtcggtcacttgatgacgaatggcgccatcgtcgacactgacggcagcgaggtgttcgaa
ggcatcatggatgccctattcaccggcctgatcgccatccacgggctaaaggccagcgac
gtcaacgggccgctgatcaacagccgcaccggctccatctacatcgtcaagccgaagatg
cacggtccggccgaggtggcgtttacctgcgaactgttcagccgggttgaagatgtgctg
gggttgccgcaaaacaccatgaagatcggcatcatggacgaggaacgccggaccacggtc
aacctcaaggcgtgcatcaaagctgccgcggaccgcgtggtgttcatcaacaccgggttc
ctggaccgcaccggcgatgaaatccacacctcgatggaggccggcccgatggtgcgcaag
ggcaccatgaagagccagccgtggatcttggcctacgaggaccacaacgtcgatgccggc
ctggccgccgggttcagcggccgagcccaggtcggcaagggcatgtggacaatgaccgag
ctgatggccgacatggtcgagacaaaaatcgcccagccgcgcgccggggccagcaccgcc
tgggttccctctcccactgcggccaccctgcacgcgctgcactaccaccaggtcgacgtc
gccgcggtgcaacaaggactggcggggaagcgtcgcgccaccatcgaacaattgctgacc
attccgctggccaaggaattggcctgggctcccgacgagatccgcgaagaggtcgacaac
aactgtcaatccatcctcggctacgtggttcgctgggttgatcaaggtgtcggctgctcg
aaggtgcccgacatccacgacgtcgcgctcatggaggaccgggccacgctgcgaatctcc
agccaattgttggccaactggctgcgccacggtgtgatcaccagcgcggatgtgcgggcc
agcttggagcggatggcgccgttggtcgatcgacaaaacgcgggcgacgtcgcataccga
ccgatggcacccaacttcgacgacagtatcgccttcctggccgcgcaggagctgatcttg
tccggggcccagcagcctaacggctacaccgagccgatcctgcaccgacgtcgtcgggag
tttaaggcccgggccggtgacgatgcggcccgctag

DBGET integrated database retrieval system