KEGG   Mycobacterium canettii CIPT 140010059: MCAN_22091Help
Entry
MCAN_22091        CDS       T01585                                 

Gene name
fadD15
Definition
(GenBank) putative long-chain-fatty-acid-CoA ligase fadD15 (fatty-acid-CoA synthetase) (fatty-acid-CoA synthase)
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
mce00061  Fatty acid biosynthesis
mce00071  Fatty acid degradation
mce01100  Metabolic pathways
mce01212  Fatty acid metabolism
mce02024  Quorum sensing
Module
mce_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:mce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    MCAN_22091 (fadD15)
   00071 Fatty acid degradation
    MCAN_22091 (fadD15)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MCAN_22091 (fadD15)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mce01004]
    MCAN_22091 (fadD15)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mce04147]
    MCAN_22091 (fadD15)
Enzymes [BR:mce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     MCAN_22091 (fadD15)
Lipid biosynthesis proteins [BR:mce01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   MCAN_22091 (fadD15)
Exosome [BR:mce04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   MCAN_22091 (fadD15)
  Exosomal proteins of breast cancer cells
   MCAN_22091 (fadD15)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: CCC44541
UniProt: G0TMV7
Position
2500828..2502630
Genome map
AA seq 600 aa AA seqDB search
MREISVPAPFTVGEHDNVAAMVFEHERDDPDYVIYQRLIDGVWTDVTCAEAANQIRAAAL
GLISLGVQAGDRVVIFSATRYEWAILDFAILAVGAVTVPIYETSSAEQVRWVLQDSEAVV
LFAETDSHATMVAELSGSVPALREVLQIAGSGPNALDRLTEAGASVDPAELTARLAALRS
TDPATLIYTSGTTGRPKGCQLTQSNLVHEIKGARAYHPTLLRKGERLLVFLPLAHVLARA
ISMAAFHSKVTVGFTSDIKNLLPMLAVFKPTVVVSVPRVFEKVYNTAEQNAANAGKGRIF
AIAAQTAVDWSEACDRGGPGLLLRAKHAVFDRLVYRKLRAALGGNCRAAVSGGAPLGARL
GHFYRGAGLTIYEGYGLSETSGGVAISQFNDLKIGTVGKPVPGNSLRIADDGELLVRGGV
VFSGYWRNEQATTEAFTDGWFKTGDLGAVDEDGFLTITGRKKEIIVTAGGKNVAPAVLED
QLRAHPLISQAVVVGDAKPFIGALITIDPEAFEGWKQRNSKTAGASVGDLATDPDLIAEI
DAAVKQANLAVSHAESIRKFRILPVDFTEDTGELTPTMKVKRKVVAEKFASDIEAIYNKE
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgagattagcgtccccgccccattcactgtcggcgagcacgacaacgtcgcggcc
atggtgttcgagcatgaacgtgacgatcccgactacgtcatctatcaacgcctgatcgac
ggcgtctggaccgatgtcacgtgtgcggaggcagccaaccagattcgtgccgcggctctc
ggtttgatttcactgggggtgcaggccggcgatcgggtagtcatcttctctgccacccgc
tacgagtgggcgatcctcgatttcgcgattctggctgtgggtgcggtcaccgtaccgatc
tacgagacctcgtcagcggagcaggtgcgctgggttttacaagactccgaagcggtggtg
ttgttcgccgaaaccgactcacacgcgacaatggtcgccgaactctccggcagcgtgccc
gccctgcgggaggtactgcagatcgccggttcgggtcccaacgcgctcgatcggctcacg
gaggcgggcgcctcggtcgacccggccgagctaaccgcccgcctcgccgcactacggtcg
acggacccggcgacacttatctacacctcgggcaccaccggacgacccaagggctgccag
ttgacccaatccaacctggttcacgagattaagggcgccagggcatatcacccgacgctg
ctgcgcaagggtgagcggctgctggttttcctgccgctagctcatgtgctggcgcgcgcg
atcagtatggccgccttccactccaaagtcaccgtgggattcaccagcgacatcaagaat
ctgctgccgatgttggcggtgttcaagcccacggtggtggtgtcggtgccgagggtgttc
gagaaggtgtacaacaccgccgagcagaacgccgccaacgccggcaaagggcgaatcttc
gcgatcgccgcgcagaccgcggtcgactggagcgaagcttgcgaccgcggcggaccgggg
ctgctactgcgcgccaagcacgcggtgttcgaccggctggtctaccgcaagctgcgtgcg
gcactgggtggcaactgccgcgccgccgtctccggcggcgcgccgctgggtgcgcggctt
ggtcacttctatcgcggcgccggtctcaccatctacgagggatacggcctgagcgagacc
agtgggggcgtcgccatcagccagttcaatgatctaaagatcggaactgtcggaaagccg
gtgcccggcaacagtctacgcatcgccgacgatggcgagctgctggtgcgcggtggcgtg
gtattcagcggctactggcgcaacgagcaggctaccaccgaggcattcaccgacggctgg
ttcaagaccggtgatctcggtgcggtggacgaagacgggttcttgacgatcaccggccgc
aagaaagaaattatcgtcaccgcgggcggtaaaaatgtcgcccccgctgtgctggaagac
cagctgcgggcccacccactgatcagccaggcggtggtggttggggacgccaagcccttc
atcggcgcgttaatcaccatcgaccctgaggcattcgagggctggaagcaacgcaacagc
aagacagctggcgcgtcggtgggcgatttggccaccgaccccgatctgattgccgagatc
gacgcggccgtcaaacaggccaatcttgcggtgtcacatgccgagtcgatccgcaagttc
cgaatactgcccgtcgacttcaccgaggacaccggcgagctgaccccgacaatgaaggtc
aaacgcaaggtggtggccgagaagttcgcttccgatatcgaggcgatctacaacaaggaa
tag

DBGET integrated database retrieval system