KEGG   Mycobacterium canettii CIPT 140010059: MCAN_25231Help
Entry
MCAN_25231        CDS       T01585                                 

Gene name
echA14
Definition
(GenBank) putative enoyl-CoA hydratase ECHA14 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase)
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
mce00071  Fatty acid degradation
mce00280  Valine, leucine and isoleucine degradation
mce00281  Geraniol degradation
mce00310  Lysine degradation
mce00360  Phenylalanine metabolism
mce00362  Benzoate degradation
mce00380  Tryptophan metabolism
mce00410  beta-Alanine metabolism
mce00627  Aminobenzoate degradation
mce00640  Propanoate metabolism
mce00650  Butanoate metabolism
mce00903  Limonene and pinene degradation
mce00930  Caprolactam degradation
mce01100  Metabolic pathways
mce01110  Biosynthesis of secondary metabolites
mce01120  Microbial metabolism in diverse environments
mce01130  Biosynthesis of antibiotics
mce01212  Fatty acid metabolism
Module
mce_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mce00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MCAN_25231 (echA14)
   00650 Butanoate metabolism
    MCAN_25231 (echA14)
  Lipid metabolism
   00071 Fatty acid degradation
    MCAN_25231 (echA14)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCAN_25231 (echA14)
   00310 Lysine degradation
    MCAN_25231 (echA14)
   00360 Phenylalanine metabolism
    MCAN_25231 (echA14)
   00380 Tryptophan metabolism
    MCAN_25231 (echA14)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCAN_25231 (echA14)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCAN_25231 (echA14)
   00281 Geraniol degradation
    MCAN_25231 (echA14)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCAN_25231 (echA14)
   00627 Aminobenzoate degradation
    MCAN_25231 (echA14)
   00930 Caprolactam degradation
    MCAN_25231 (echA14)
Enzymes [BR:mce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCAN_25231 (echA14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CCC44854
UniProt: G0TPW1
Position
2856220..2856990
Genome map
AA seq 256 aa AA seqDB search
MAQYDPVLLSVDKHVALITVNDPDRRNAVTDEMSAQLRAAIQRAEGDPDVHAVVVTGAGK
AFCAGADLSALGAGVGDPAEPRLLRLYDGFMAVSSCNLPTIAAVNGAAVGAGLNLALAAD
VRIAGPAALFDARFQKLGLHPGGGATWMLQRAVGPQVARAALLFGMCFDAESAVRHGLAL
MVADDPVAAALELAAGPAAAPREVVLASKATMRATASPGSLDLEQHELAKRLELGPQAKS
VQSPEFAARLAAAQHR
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcccaatacgacccggtcttgctcagcgtcgacaagcacgttgcgctcatcacggtc
aacgacccggaccgacggaacgccgtcaccgacgagatgtcggcgcagttgcgtgcggcg
atccaacgcgccgaaggcgaccccgacgtacacgccgtagtcgtgaccggggcgggcaag
gccttctgcgccggggccgacctgagtgcgctgggcgccggggtcggcgatccagccgag
ccgagattgttacggctctacgacggtttcatggccgtcagtagttgtaatctgcccacc
atcgccgcggtcaacggcgcggctgtgggcgccggactcaatctggcgttggccgccgat
gtgcgcatcgccggaccggccgcattgttcgacgcccgcttccaaaagctgggactgcat
ccaggtggcggcgcaacctggatgctgcagcgagcggtgggtccgcaggtcgcccgtgcg
gccttattgttcggcatgtgcttcgacgccgaatccgctgtgcggcacggcttggcgcta
atggttgccgacgatcccgtcgccgcggcgctggagctggccgccgggcccgcagccgcc
ccgcgcgaggtcgtgctggcgagcaaagccaccatgcgcgccacagccagccccggatcg
ctggaccttgagcaacacgaactcgccaaacgcttagaacttgggccgcaggcgaaatcg
gtccagtcgcccgagttcgccgctcgcttggctgccgctcaacacaggtag

DBGET integrated database retrieval system