KEGG   Mycobacterium canettii CIPT 140010059: MCAN_31381Help
Entry
MCAN_31381        CDS       T01585                                 

Gene name
moaB1
Definition
(GenBank) putative pterin-4-alpha-carbinolamine dehydratase MOAB1 (PHS) (4-alpha-hydroxy-tetrahydropterin dehydratase) (pterin-4-A-carbinolamine dehydratase) (phenylalanine hydroxylase-stimulating protein) (PHS) (pterin carbinolamine dehydratase) (PCD)
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
mce00790  Folate biosynthesis
mce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MCAN_31381 (moaB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mce04147]
    MCAN_31381 (moaB1)
Enzymes [BR:mce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     MCAN_31381 (moaB1)
Exosome [BR:mce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MCAN_31381 (moaB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: CCC45469
UniProt: G0TGW3
Position
3544914..3545309
Genome map
AA seq 131 aa AA seqDB search
MTVSTPEQHEQRASHDASEGKHNVCQGRLAALADAAVSEKLGALPGWQLLDMRLSRAFQC
TNFDQSIDFMNRVASIANDINHHPDIAVLDKRSVRVTAWTRKLGYLTDIDFDLAASVEAM
YATEFADRPAR
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcagcacccctgagcaacacgagcaacgagcatcccacgatgcatccgaggga
aagcacaacgtatgtcaggggaggctggccgcacttgccgacgcggccgtgtcagagaaa
ctcggagcactacctggctggcagcttctcgacatgcgactcagccgcgcttttcagtgc
acaaatttcgaccaatccattgacttcatgaatagggtcgcatcaatagcaaacgatatc
aatcaccatcccgatatcgctgtactggacaagcgttcggtgcgcgtgacggcgtggacg
cgcaagctgggctatctgaccgacatcgacttcgatcttgcggcgtccgtcgaggcgatg
tatgcgacagaattcgctgacaggccagcacgatga

DBGET integrated database retrieval system