KEGG   Mycobacterium canettii CIPT 140010059: MCAN_31901Help
Entry
MCAN_31901        CDS       T01585                                 

Definition
(GenBank) putative amidase (aminohydrolase)
  KO
K01426  amidase [EC:3.5.1.4]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
mce00330  Arginine and proline metabolism
mce00360  Phenylalanine metabolism
mce00380  Tryptophan metabolism
mce00627  Aminobenzoate degradation
mce00643  Styrene degradation
mce01100  Metabolic pathways
mce01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    MCAN_31901
   00360 Phenylalanine metabolism
    MCAN_31901
   00380 Tryptophan metabolism
    MCAN_31901
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    MCAN_31901
   00643 Styrene degradation
    MCAN_31901
Enzymes [BR:mce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     MCAN_31901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CCC45521
UniProt: G0THE8
Position
3600066..3601553
Genome map
AA seq 495 aa AA seqDB search
MAMSAKASDDIAWLPATAQLAALAAKKVSSAELVELYLSRIDTYNASLNAIVTVDPDAAR
RVAKRSDAARARGDELGPLHGLPITVKDSYETAGMRTTCGRRDLADYVPTQDAEAVARLR
RAGAIIMGKTNMPTGNQDVQASNPVFGRTNNPWDAARTSGGSAGGGAAATAAGLTSFDYG
SEIGGSTRIPAHYCGLYGHKSTWRSVPLVGHIPSAPGNPGRWGQADMACAGVQVRGARDI
IPALEATVGPMRADGGFSYALAPPRAGALKDFRVAVWAEDPHCPIDADARRAMDDAVAAL
RAAGAHVVEQPATIPVDMAVSHNIFQSLVFGAFAVDRSTLSPASAAALGLRAVWHPRGEA
ANALRATLQSHRAWLFADAARHEMRDRWAGFFNEFDVLLLPVTPTPAPLHHNKDHDRLGR
TIDVDGVSRSYWDQLKWNALANIAGTPATTMPITTTATGLPIGIQAMGPAGGDRTTVEFA
ALLTEVLGGFRVPPL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggccatgtccgccaaggcctcagacgatattgcctggctaccggcgaccgctcaactc
gcggcgctcgccgccaagaaggtgtccagcgcggagttagtcgagctgtatctttcccga
atcgacacgtacaacgcgtcgctcaacgcgatcgtcaccgttgaccccgacgccgcccga
cgcgtcgccaagcgatccgatgcggcacgagcccgcggcgacgaactcggcccgttgcat
gggttgccgatcaccgtcaaggacagctatgagacggccggcatgcgcacgacctgcggt
cgccgcgaccttgccgactatgtacccacccaggacgccgaggcggtcgcccggttgcgc
cgggccggcgcgatcatcatgggcaagacaaacatgcccaccggcaaccaggacgtccag
gccagcaatccggtcttcggccgcaccaacaacccatgggacgccgcgcgcacgtccggc
ggctcggccggcggcggggcggccgccaccgcggccgggctgaccagcttcgactacggc
tcggagatcggcggctctaccaggatcccggctcattactgcggtctgtacggccacaaa
tcgacctggcgctcggttcctctggtcgggcacattcccagcgcaccaggtaatcccggg
cgatgggggcaagccgacatggcctgcgcgggcgtgcaggtgcgcggtgcccgcgacatc
atccccgcactggaggcgaccgtcgggccgatgcgggcggacggaggattctcgtatgcg
ctcgctccgccacgagccggcgcgctcaaagacttccgggtcgcggtctgggccgaggac
ccgcattgcccaattgacgccgacgcgcgtcgggccatggatgatgctgtcgccgcgctg
cgcgccgcgggcgcacacgtcgttgagcagcccgccaccatcccggtcgatatggcggtg
tcgcacaacatcttccagagtctggtgttcggcgccttcgctgtcgaccggtccaccctc
agcccagcctccgccgccgcgctcggattacgcgcggtttggcatcctcggggcgaagcc
gccaacgccctgcgtgcgacgctacagagccaccgtgcgtggttgttcgccgatgcggcg
cgccacgaaatgcgcgaccggtgggccggattcttcaacgagttcgacgtgctgctcctg
cccgtcacgcccacccccgcgccgctccaccacaacaaggaccacgaccggttgggccgc
accatcgacgtcgacggcgtctcacgctcgtactgggaccaactcaaatggaacgcgctg
gccaacatcgccggcaccccggccaccaccatgcccatcaccaccacagctaccggactc
ccgatcggcatccaggcgatggggcccgcgggcggagaccgcaccaccgtagagttcgcc
gccctgctcaccgaagtcctaggcggcttccgcgttccccctctttag

DBGET integrated database retrieval system