KEGG   Mycobacterium canettii CIPT 140010059: MCAN_34851Help
Entry
MCAN_34851        CDS       T01585                                 

Gene name
mhpE
Definition
(GenBank) putative 4-hydroxy-2-oxovalerate aldolase MHPE (HOA)
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
mce00360  Phenylalanine metabolism
mce00362  Benzoate degradation
mce00621  Dioxin degradation
mce00622  Xylene degradation
mce01100  Metabolic pathways
mce01120  Microbial metabolism in diverse environments
mce01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    MCAN_34851 (mhpE)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCAN_34851 (mhpE)
   00622 Xylene degradation
    MCAN_34851 (mhpE)
   00621 Dioxin degradation
    MCAN_34851 (mhpE)
Enzymes [BR:mce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     MCAN_34851 (mhpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like ComA
Motif
Other DBs
NCBI-ProteinID: CCC45816
UniProt: G0TIX2
Position
complement(3945333..3946343)
Genome map
AA seq 336 aa AA seqDB search
MLMTATHREPIVLDTTVRDGSYAVNFQYTDDDVGRIVGDLDAAGIPYIEIGHGVTIGATA
AQGPAAHTDEEYFRAARSVVRNAKLGAVIVPALARIETVDLAGDYLDFLRICVIATEFEL
VMPFVERAQSKGLEVSIQLVKSHLFEPDVLAAAGKRARDVGVRIVYVVDTTGTFLPEDAR
RYVEALRGASDVTVGFHGHNNLAMAVANTLEAFDAGADFLDGTLMGFGRGAGNCQTECLI
AALQRRGYLVGVDLDRLFDAARSDMLGRSPQSYGIDPWEISFGFHGLDSLQVEYLRAAAQ
RARLSVPRVIRQTAESLAATWLSPQDIDRVVVGMRA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgctcatgactgcgacccacagagagccgattgtcctggacacgaccgtccgtgacggc
agctatgcggtgaacttccagtacaccgacgacgatgtcggcaggattgtcggggatctc
gacgcagcgggaattccctacattgaaatcggtcacggcgtcaccatcggagccaccgcg
gcgcagggcccggccgctcacaccgacgaagaatatttccgcgccgcccgatcggtggtt
cgaaacgcgaaactgggtgccgtgatcgtcccggccctggcccgcatcgagacggttgat
ttggccggagactatctggactttctgcgcatatgtgtcatcgccaccgaatttgagttg
gtgatgccgttcgtcgagcgcgcgcagtcaaaaggcctcgaggtttcgatccagctggtg
aagtcgcatctcttcgagcccgatgtgcttgccgctgccgggaagcgggcccgcgatgtg
ggcgtccggatcgtttacgtggtggatacgacgggaaccttcctgcccgaggacgcgcgc
cgctacgtcgaggctctccgcggcgccagcgatgtcaccgtcggcttccacgggcacaac
aacctcgccatggccgtcgccaacaccttggaggcattcgacgccggggccgatttcctg
gacggaacgctgatgggctttggtcgcggggccgggaattgccagaccgagtgcctcatc
gccgcgttgcagcgccgtggatacctggtcggggtagacctggatcggcttttcgacgca
gcgcgatcggatatgttgggccggagcccgcagagttacggcatcgatccgtgggagatc
tcgttcggattccatggactcgattcgttgcaggttgaatacctgcgcgcggcggcgcaa
cgggcgcggctttcggtgccccgcgttatccggcagaccgcggaaagtctggcggcgaca
tggttgtcgccgcaagacatcgatcgggtggtcgtgggaatgagggcgtga

DBGET integrated database retrieval system