KEGG   Mycobacterium canettii CIPT 140010059: MCAN_35571Help
Entry
MCAN_35571        CDS       T01585                                 

Gene name
fadA5
Definition
(GenBank) putative acetyl-CoA acetyltransferase FADA5 (acetoacetyl-CoA thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
mce00071  Fatty acid degradation
mce00072  Synthesis and degradation of ketone bodies
mce00280  Valine, leucine and isoleucine degradation
mce00310  Lysine degradation
mce00362  Benzoate degradation
mce00380  Tryptophan metabolism
mce00620  Pyruvate metabolism
mce00630  Glyoxylate and dicarboxylate metabolism
mce00640  Propanoate metabolism
mce00650  Butanoate metabolism
mce00900  Terpenoid backbone biosynthesis
mce01100  Metabolic pathways
mce01110  Biosynthesis of secondary metabolites
mce01120  Microbial metabolism in diverse environments
mce01130  Biosynthesis of antibiotics
mce01200  Carbon metabolism
mce01212  Fatty acid metabolism
mce02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MCAN_35571 (fadA5)
   00630 Glyoxylate and dicarboxylate metabolism
    MCAN_35571 (fadA5)
   00640 Propanoate metabolism
    MCAN_35571 (fadA5)
   00650 Butanoate metabolism
    MCAN_35571 (fadA5)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCAN_35571 (fadA5)
   00072 Synthesis and degradation of ketone bodies
    MCAN_35571 (fadA5)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCAN_35571 (fadA5)
   00310 Lysine degradation
    MCAN_35571 (fadA5)
   00380 Tryptophan metabolism
    MCAN_35571 (fadA5)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MCAN_35571 (fadA5)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCAN_35571 (fadA5)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MCAN_35571 (fadA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mce04147]
    MCAN_35571 (fadA5)
Enzymes [BR:mce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MCAN_35571 (fadA5)
Exosome [BR:mce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MCAN_35571 (fadA5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CCC45888
UniProt: G0TJH8
Position
4037740..4038915
Genome map
AA seq 391 aa AA seqDB search
MGYPVIVEATRSPIGKRNGWLSGLHATELLGAVQKAVVDKAGIQSGLHAGDVEQVIGGCV
TQFGEQSNNISRVAWLTAGLPEHVGATTVDCQCGSGQQANHLIAGLIAAGAIDVGIACGI
EAMSRVGLGANAGPDRSLIRAQSWDIDLPNQFEAAERIAKRRGITREDVDVFGLESQRRA
QRAWAEGRFDREISPIQAPVLDEQNQPTGERRLVFRDQGLRETTMAGLGELKPVLEGGIH
TAGTSSQISDGAAAVLWMDEAVARAHGLTPRARIVAQALVGAEPYYHLDGPVQSTAKVLE
KAGMKIGDIDIVEINEAFASVVLSWARVHEPDMDRVNVNGGAIALGHPVGCTGSRLITTA
LHELERTDQSLALITMCAGGALSTGTIIERI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgggttacccggtcatcgttgaagccacccgcagccccatcggcaaacgcaacggatgg
ctgtcggggctgcatgccaccgagttgttgggcgcggtgcaaaaggcggtggtcgacaag
gccggcatccagtccggccttcacgccggtgacgtcgaacaggtcatcggcggttgcgtg
acccagttcggggagcaatccaacaacatcagccgggtggcctggctgacggccggtttg
cccgaacacgtcggcgccaccaccgtcgactgccagtgcggcagcggccagcaggccaac
catctgattgccgggttgatcgcggccggtgccatcgatgtcggcatcgcctgcggcatc
gaggcgatgagccgggtcgggctgggcgccaacgccgggccggaccgctcgctgatccgc
gcgcagtcatgggatatcgacctgccgaaccagttcgaggccgccgagcggatcgccaag
cggcgcggcatcacccgcgaggacgtggatgtcttcgggctcgagtcgcagcgacgcgcg
cagcgggcctgggcggagggccgctttgaccgcgagatctcgccgatccaggcgccggtg
ctcgacgagcagaatcagcccaccggcgagcggcgcctggtctttcgcgaccagggcctg
cgcgagaccacgatggcggggctaggcgagctgaaaccggtgctcgagggcggcatccac
accgcgggcacgtcgtcgcagatctccgacggcgcggcagccgtgttgtggatggacgaa
gccgtggcacgtgcgcacggcctgaccccgcgggcccggatcgtcgcccaggcactcgtc
ggcgccgagccctactaccacctggacggcccggtgcagtccaccgcgaaggtgctggag
aaggccggcatgaagatcggcgacatcgacatcgtcgagatcaacgaggcgttcgcgtcc
gtggtgctgtcctgggcgcgggtgcacgagcccgacatggaccgggtcaacgtcaacggc
ggggcgatcgcgctggggcatccggtgggctgcaccggcagccggctgatcaccaccgcc
ctgcacgagctcgagcgcaccgaccagagcctcgcgctgatcaccatgtgcgccggcggg
gccctgtccaccggcaccatcatcgagcggatttaa

DBGET integrated database retrieval system