KEGG   Macaca fascicularis (crab-eating macaque): 101864777Help
Entry
101864777         CDS       T02918                                 

Gene name
PYCR2
Definition
(RefSeq) pyrroline-5-carboxylate reductase family member 2
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00330  Arginine and proline metabolism
mcf01100  Metabolic pathways
mcf01230  Biosynthesis of amino acids
Module
mcf_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    101864777 (PYCR2)
Enzymes [BR:mcf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     101864777 (PYCR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P5CR_dimer F420_oxidored Rossmann-like 2-Hacid_dh_C NAD_Gly3P_dh_N OCD_Mu_crystall ApbA
Motif
Other DBs
NCBI-GeneID: 101864777
NCBI-ProteinID: XP_005541057
UniProt: Q4R6W7
Position
1
AA seq 320 aa AA seqDB search
MSVGIIGAGQLAYALARGFTAAGIVSAHKIIASSPEMNLPTVSALRKMGVNLTRSNKETV
KHSDVLFLAVKPHIIPFILDEIGADVQARHIVVSCAAGVTISSVEKKLMAFQPAPKVIRC
MTNTPVVVREGATVYAMGTHALVEDGQLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAY
AFMALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLDSEQHPCQLKDNVCSPGGATIH
ALHFLESGGFRSLLINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTL
TPSSPGKLLTRSLALGGKKD
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgggcatcatcggagccggccagctggcctatgctctggcgcggggcttcacg
gccgcaggtatcgtgtcggctcacaagataatagccagctctccggaaatgaacctgccc
acggtgtcggccctcaggaagatgggtgtgaacctgacacgcagcaacaaggagacagtg
aagcacagcgacgtcctgtttctggccgtgaagccacatatcatccccttcattctggat
gagattggggccgatgtacaagccagacacatcgtggtctcctgtgcggctggtgtcacc
atcagctctgtggagaagaagctgatggcgttccagccagcccccaaagtgattcgctgc
atgaccaacacacctgtggtagtgcgggaaggcgctacagtgtacgccatgggcacccat
gctctggtggaggatgggcagctcctggagcagctcatgagcagcgtgggcttctgcact
gaggtggaagaggacctcatcgatgccgtcacggggctcagtggcagcgggcctgcctat
gcattcatggctctggatgcattggctgatggtggggtgaagatgggtttgccacggcgc
ctggcagtccgactcggggcccaggccttgctgggagctgccaagatgctgctggactca
gagcagcatccatgccagctcaaggacaatgtctgctcccctgggggagccaccatccac
gccctgcactttctggagagtgggggcttccgctctctgctcatcaatgcagttgaggcc
tcctgtatccgaacacgagagctacagtccatggccgaccaagaaaagatctccccagct
gcccttaagaagacgctcctagacagagtgaagctggaatcccccacagtctccacactg
accccctccagcccagggaagctccttacaagaagcctggccctgggtggcaagaaggac
taa

DBGET integrated database retrieval system