KEGG   Macaca fascicularis (crab-eating macaque): 101864901Help
Entry
101864901         CDS       T02918                                 

Gene name
CAMK4
Definition
(RefSeq) calcium/calmodulin dependent protein kinase IV
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04020  Calcium signaling pathway
mcf04024  cAMP signaling pathway
mcf04211  Longevity regulating pathway
mcf04371  Apelin signaling pathway
mcf04380  Osteoclast differentiation
mcf04720  Long-term potentiation
mcf04722  Neurotrophin signaling pathway
mcf04725  Cholinergic synapse
mcf04921  Oxytocin signaling pathway
mcf04925  Aldosterone synthesis and secretion
mcf05031  Amphetamine addiction
mcf05034  Alcoholism
mcf05214  Glioma
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101864901 (CAMK4)
   04020 Calcium signaling pathway
    101864901 (CAMK4)
   04024 cAMP signaling pathway
    101864901 (CAMK4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101864901 (CAMK4)
   04925 Aldosterone synthesis and secretion
    101864901 (CAMK4)
  09156 Nervous system
   04725 Cholinergic synapse
    101864901 (CAMK4)
   04720 Long-term potentiation
    101864901 (CAMK4)
   04722 Neurotrophin signaling pathway
    101864901 (CAMK4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101864901 (CAMK4)
  09149 Aging
   04211 Longevity regulating pathway
    101864901 (CAMK4)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    101864901 (CAMK4)
  09165 Substance dependence
   05031 Amphetamine addiction
    101864901 (CAMK4)
   05034 Alcoholism
    101864901 (CAMK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcf01001]
    101864901 (CAMK4)
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101864901 (CAMK4)
Protein kinases [BR:mcf01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   101864901 (CAMK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like FTA2 DUF1103 Kdo Pkinase_fungal APH YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 101864901
NCBI-ProteinID: XP_005557557
UniProt: A0A2K5W3H1
Position
6
AA seq 473 aa AA seqDB search
MLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWV
TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGNIQESHKASRDPS
PIQDGNEDMKAIPEGEKIQSDGAQAAVKGAQAELMKVQALEKVKGSDINAEEVPRMVPKA
VEDGIKVADLELEKGLAEEKLKTVEEVAAPREGQGSSAVGFDIPQQDVILPEY
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagtcacggtgccctcctgctccgcctcgtcctgctcttcggtcaccgccagt
gcggccccggggaccgcgagcctcgtcccggattactggatcgacggctccaacagggat
gcgctgagcgatttcttcgaggtggagtcggagctgggacggggtgctacatccattgtg
tacagatgcaaacagaaggggacccagaagccttatgctctcaaagtgttaaagaaaaca
gtggacaaaaaaatcgtaagaactgagataggagttcttcttcgcctctcacatccaaac
attataaaacttaaagagatatttgaaacccctacagaaatcagtctggtcctagaactc
gtcacaggaggagaactgtttgataggattgtggaaaagggatattacagtgagcgagat
gctgcagatgctgttaaacaaatcctggaggcagtcgcttatctacatgaaaatggaatt
gtccatcgtgatctcaaaccagagaatcttctctatgcaactccagccccagatgcacca
ctcaaaatcgctgattttggactctctaaaattgtggaacatcaagtgctcatgaagaca
gtatgtggaaccccagggtactgcgcacctgaaattcttagaggttgtgcctatggacct
gaggtggacatgtggtctgtaggaataatcacctacatcttactttgtggatttgaacca
ttctatgatgaaagaggcgatcagttcatgttcagaagaattctgaattgtgaatattac
tttatctccccctggtgggatgaagtatctctaaatgccaaggacttggtcagaaaatta
attgttttggatccaaagaaacggctgactacctttcaagctctccagcatccgtgggtc
acaggtaaagcagccaattttgtacacatggataccgctcaaaagaagcttcaagaattc
aatgctcggcgtaagcttaaggcagcggtgaaggctgtggtggcctcttcccggctggga
agtgccagcagcagccatggcaacatccaggagagccacaaggctagccgagacccttct
ccaatccaagacggcaacgaggacatgaaagctattccagaaggagagaaaattcaaagc
gatggggcccaagccgcagttaagggggcacaggctgagctgatgaaggtgcaagcctta
gagaaagttaaaggttcagatataaatgctgaagaggtccccaggatggtgcccaaggca
gtggaggatgggataaaggtggctgacctggaactagagaagggcctagcagaggagaag
ctgaagactgtggaggaagtagcagctcccagggaagggcaaggaagctctgctgtgggc
tttgacattccacagcaagatgtgatcctgccagagtactaa

DBGET integrated database retrieval system