KEGG   Macaca fascicularis (crab-eating macaque): 101865014Help
Entry
101865014         CDS       T02918                                 

Gene name
TPP2
Definition
(RefSeq) tripeptidyl peptidase 2
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcf01002]
    101865014 (TPP2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mcf03110]
    101865014 (TPP2)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     101865014 (TPP2)
Peptidases and inhibitors [BR:mcf01002]
 Serine peptidases
  Family S8: subtilisin family
   101865014 (TPP2)
Chaperones and folding catalysts [BR:mcf03110]
 Intramolecular chaperones
  Subtilisin family
   101865014 (TPP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII TPPII_N
Motif
Other DBs
NCBI-GeneID: 101865014
NCBI-ProteinID: XP_005586246
Position
17
AA seq 1304 aa AA seqDB search
MATAATEEPFPFHGLLPKKETGAASFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDG
KPKIVDIIDTTGSGDVNTATEVEPKDGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDF
YPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQANKLIKEELQSQVEL
LNSFEKKYSDPGPVYDCLVWHDGEVWRACIDSNEDGDLSKSTVLRNYKEAQEYGSFGTAE
MLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTR
LSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNIIYVSSA
GNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSLREKLPANQYTWSSRGPSADGAL
GVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALILSGLKANNIDYTVHSVRR
ALENTAVKADNIEVFAQGHGIIQVDKAYDYLVQNTSFANKLGFTVTVGNNRGIYLRDPVQ
VAAPSDHGVGIEPVFPENTENSEKISLQLHLALTSNSSWVQCPSHLELMNQCRHINIRVD
PRGLREGLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESSHYDLAFTDVHFKPGQIR
RHFIEVPEGATWAEVTVCSCSSEVSAKFVLHAVQLVKQRAYRSHEFYKFCSLPEKGTLTE
AFPVLGGKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGINRFDVQSSLK
YEDLAPCITLKNWVQTLRPVSAKTKPLGSRDVLPNNRQLYEMVLTYNFHQPKSGEVTPSC
PLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYPHQYSLKLEKGDYTIRLQIRHEQISDL
ERLKDLPFIVSHRLSNTLSLDIHENHSFALLGKKKSSNLTLPPKYNQPFFVTSLPDDKIP
KGAGPGCYLAGSLTLSKTELGKKAGQSAAKRQGKFKKDVIPVHYYLIPPPTKTKNGSKDK
EKDSEKEKDLKEEFTEALRDLKIQWMTKLDSSDIYNELKETYPNYLPLYVARLHQLDAEK
ERMKRLNEIVDAANAVISHIDQTALAVYIAMKTDPRPDAATIKKLPSDFCIIPALLWAAR
IHQAAFAESALQTLAERRMKGVLRHSDMDKQKSTLVDALCRKGCALADHLLHTQAQDGAI
STDAEGKEEEGESPLDSLAETFWETTKWTDLFDNKVLTFAYKHALVNKMYGRGLKFATKL
VEEKPTKENWKNCIQLMKLLGWTHCASFTENWLPIMYPPDYCVF
NT seq 3915 nt NT seq  +upstreamnt  +downstreamnt
atggccactgctgcgactgaggagcccttcccttttcacggtctcctgccgaagaaggag
accggagccgcctccttcctctgccgctacccggagtatgacgggcggggggtactcatc
gccgtcctggacacgggggtggacccgggggctccgggcatgcaggttacaactgatgga
aaaccaaaaattgttgatatcattgatacaacaggaagtggcgatgtgaatactgctacg
gaagtagagccgaaggatggtgaaattgttggcctttcaggaagagtgcttaagattcct
gcaagctggacaaatccctcaggcaaatatcatattggcataaaaaatggctatgacttc
tatcctaaggctctcaaggaaaggatacagaaagaacggaaggaaaagatctgggaccct
gttcacagagtggcccttgcagaagcctgtagaaaacaggaagaatttgatgttgccaac
aacgggtcttctcaagcaaataaactcatcaaggaggagcttcaaagtcaagtggaattg
ctgaattctttcgagaagaaatacagcgatcctggccctgtatatgactgcttggtgtgg
catgatggtgaagtctggagagcctgcattgattctaatgaagatggggacttgagtaaa
tctaccgtattgagaaactacaaagaagcccaagaatatggctcttttggcacagctgag
atgttgaattactccgttaatatatacgatgatggaaacctgctctccattgtgaccagc
ggaggagctcatgggacacatgtagctagtatagctgctggacactttccagaagaacct
gaacggaatggggtagctcctggtgctcaaattctttccatcaagattggtgatacaaga
ctaagcacaatggaaacaggcacaggcctcataagagctatgatagaagttataaatcat
aagtgtgatcttgtcaactacagttacggagaagcaactcactggccaaattctgggaga
atttgtgaagtaattaatgaagcagtatggaagcataatataatttatgtttcaagtgct
ggaaataatggtccatgcctgtctacagttggttgtccaggtggaactacatcaagtgtg
ataggtgttggtgcttatgtttctcctgatatgatggttgctgagtattcactgagagag
aaattacctgcaaatcaatacacttggtcttctagaggacctagtgctgacggggccctt
ggtgtgagtatcagtgcaccaggaggagccattgcttctgttcctaactggacattgaga
gggacgcagctaatgaatggaacatctatgtcttcccccaatgcatgtggaggcattgcc
ctgatcctttcaggtctgaaagctaataacattgactacacagttcattcagtcagaaga
gctctagaaaacactgcagtgaaggctgacaatatagaagtatttgctcaaggacatggt
attattcaggttgataaagcctatgactacctcgttcagaatacatcatttgctaataaa
ttaggttttactgttactgttggaaataaccgtggcatctacctccgagatcctgttcag
gtggctgcaccttcagatcatggcgttggcattgaacctgtatttccagagaacacagaa
aactctgaaaaaatatcccttcagcttcatttagctctgacttcaaattcatcttgggtt
cagtgtcctagccatttggaactcatgaatcaatgtagacacataaacatacgtgtggat
cccaggggcttaagagaaggattgcattatacagaggtatgtggctatgatatagcatcc
cctaacgcaggtccgctcttccgagttcccatcactgcagttatagcagccaaagtaaat
gaatcatcacattacgatctagcctttacagatgtacactttaaacctggccaaattcga
aggcattttattgaggttcctgagggtgcaacatgggctgaagtgacagtgtgttcatgt
tcttctgaggtgtcagcaaagtttgttcttcatgcagtccagcttgtgaagcaaagagca
tatcgaagccatgaattctataagttttgttctcttccagagaaaggaacactgactgaa
gcttttcctgtcctaggtggaaaagcaattgaattttgcattgctcgttggtgggcaagt
ctcagtgatgtcaacattgattataccatttctttccatgggatagtgtgtactgctcct
cagttaaacattcatgcgtcggaaggaatcaaccgttttgatgttcagtcctccttgaaa
tatgaagatctggctccctgcataactttgaagaactgggtccaaacactacgcccagtg
agtgcaaaaacaaaacctttaggatcaagagatgttttgccaaataaccgtcaactttat
gagatggtcctgacatataactttcatcaacccaagagtggggaagtaactccaagctgc
ccactactttgcgaactattatatgaatctgaatttgacagccaactgtggattattttt
gaccagaacaaaagacagatgggttcaggtgatgcctatccacatcagtattctttgaaa
ctggagaaaggagattatacaattcgactgcaaattcgccatgagcaaatcagtgatttg
gaacgccttaaagaccttccatttattgtttctcatagattgtctaataccttgagctta
gatattcatgaaaatcatagttttgcacttctagggaagaagaaatcgagcaacttgaca
ttaccacccaaatataaccagccattctttgttacttccttacctgacgataaaatacct
aaaggggcaggacctggatgctatcttgcaggatccttaacattgtcaaagactgaacta
ggaaagaaagctgggcagtctgcagcaaaacgacaaggaaaatttaaaaaggatgtaatc
cctgttcattactacttaatacctccaccaacaaagactaagaacggcagcaaagataag
gaaaaagattcagaaaaagagaaagatttgaaagaagagtttactgaagcattacgagat
cttaaaattcagtggatgacaaagctggattctagtgacatttataacgaattgaaagaa
acatatcctaattatcttcctctgtacgttgctcgacttcatcaattggatgctgaaaag
gaacgaatgaaaagacttaatgaaattgttgacgcggcaaatgctgttatttctcatata
gatcaaacagccctagcagtttatattgcgatgaagactgatcccaggcctgatgcagct
actataaaaaagttgccttctgatttctgcatcattccagcccttctctgggcagccagg
atccatcaggcagcatttgccgagtctgccctgcagactctggccgagcgacggatgaaa
ggagtactcagacacagtgacatggacaaacaaaaatccaccctcgtagatgccctttgt
aggaaaggttgtgccctggcagaccatcttcttcacacccaggctcaagatggagccatc
tccactgatgcagaaggaaaagaggaagaaggagaaagtcctttggattctctggcagaa
acattttgggaaactactaaatggactgatctttttgacaataaggttttgacatttgca
tataaacatgcattagtaaataaaatgtatgggagaggccttaaatttgcaactaaactt
gtggaagaaaaaccaacaaaagaaaactggaaaaattgtattcaactgatgaagttactt
ggatggacccattgtgcatcttttactgaaaactggctccccatcatgtatcctcccgat
tattgcgtattctaa

DBGET integrated database retrieval system