KEGG   Macaca fascicularis (crab-eating macaque): 101865138
Entry
101865138         CDS       T02918                                 

Gene name
TM7SF2
Definition
(RefSeq) transmembrane 7 superfamily member 2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00100  Steroid biosynthesis
mcf01100  Metabolic pathways
Module
mcf_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    101865138 (TM7SF2)
Enzymes [BR:mcf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     101865138 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 101865138
NCBI-ProteinID: XP_005577381
Position
14
AA seq 482 aa
MGRGRVHLKTLGQERSLSALGVQAGAGAAGPDPPRGQVHLLGNGADCVSLTDYCERPLSG
GAETMAPPEGPRAPLEFGGPLGAAALLLLLPATMFHLLLAARSGPARLLGPPASLPGLEA
LWSPRALLLWLAWLGLQAALYLLPARKVAEGQELKDKSRLRYPINGFQALVLTALLVGLG
VSAGLPLGALPEMLLPLAFVATLTAFIFSLFLYMKAQVAPVSALAPGGISGNPIYDFFLG
RELNPRICFFDFKYFCELRPGLIGWVLINLALLVKEAELRGSPSLAMWLVNGFQLLYVGD
ALWHEEAILTTMDITHDGFGFMLAFGDIAWVPFTYSLQAQFLLRHPQPLGLPMASAICLI
NAIGYYIFRGANSQKNTFRKNPSDPRVAGLETISTATGRKLLVSGWWGMVRHPNYLGDLI
MALAWSLPCGVSHLLPYFYLLYFTALLVHREARDERQCLQKYGLAWQEYCRRVPYRIVPY
IY
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgggcagggggcgggtccatttaaaaaccctgggacaagagcggtccttgtctgcactc
ggtgtccaggcaggtgcaggcgccgcggggccggatcctccgcgcggacaagtccatctc
ctgggaaatggggcggactgtgtttccttgaccgactattgtgagcgccctctctccggc
ggagcggagaccatggcccctcctgagggcccccgggccccgctggaattcggagggccc
ctgggcgccgcggctctgctgctgctgctgcccgccaccatgttccacctgctcctggcg
gcccgttcgggccccgcgcgcctgctgggtccacccgcgtccctgcctgggctggaggcg
ctgtggagcccacgggcgctgctgctgtggctcgcctggctcggcctgcaggcggcgctc
tacctactgccggcgcgcaaggtggctgaggggcaggaattgaaggacaagagtcgcctg
cgctatccgattaacggcttccaggccctggtgctgacagccctgttggtggggctgggg
gtgtcagcggggctgcctctgggggcgctcccggaaatgctcctgcctttggcgtttgtc
gccaccctcaccgctttcatcttcagcctctttctctacatgaaggcgcaggtagcccca
gtttcggccctggcacctggggggatctcaggcaatccgatttacgacttttttctggga
cgggagctcaaccctcgtatctgtttcttcgacttcaaatatttctgtgaactgcgacct
ggcctcatcggctgggtcctcatcaacctggccctgttggtgaaggaggcagaacttcgg
ggcagtccctcactggccatgtggctggttaatggcttccagttactctatgtgggtgat
gccctctggcatgaggaggccatcctcaccaccatggatatcacacatgacgggtttggc
ttcatgctggcatttggggacatagcctgggtgcccttcacctacagcctgcaagcccag
ttcctgctgcgccacccgcagcccctggggttgcccatggcttccgccatctgcctcatc
aatgctattggttactacatcttccgtggggcgaattcccagaaaaacactttccgaaag
aatccttctgaccccagagtggctgggcttgagaccatctctacagccacagggcggaaa
ctgctggtgtctgggtggtggggtatggtccgccatcccaactaccttggagacctcatc
atggctctggcttggtccttgccctgtggggtgtcacacctgctgccctacttctacctc
ctctacttcaccgcgctgctggtgcaccgtgaggcccgggatgagcggcagtgcctgcag
aagtatggcctggcatggcaggagtactgccggcgtgtgccttaccgcatcgtgccctac
atctactga

DBGET integrated database retrieval system