KEGG   Macaca fascicularis (crab-eating macaque): 101865536Help
Entry
101865536         CDS       T02918                                 

Gene name
AKR1C1, DD1, dd-1
Definition
(RefSeq) Aldo-keto reductase family 1 member C1 homolog
  KO
K00212  20alpha/3alpha-hydroxysteroid dehydrogenase / dihydrodiol dehydrogenase [EC:1.1.1.149 1.1.1.357 1.3.1.20]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00140  Steroid hormone biosynthesis
mcf00980  Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    101865536 (AKR1C1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101865536 (AKR1C1)
Enzymes [BR:mcf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.149  20alpha-hydroxysteroid dehydrogenase
     101865536 (AKR1C1)
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     101865536 (AKR1C1)
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.20  trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
     101865536 (AKR1C1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 101865536
NCBI-ProteinID: NP_001270462
UniProt: I7G981
Position
9
AA seq 323 aa AA seqDB search
MDSKHQCVKLNDGHFMPVLGFGTYAPAEVPKNKALEATKLAIEAGFRHIDSAHLYNNEEY
VGLAIRSKIADGTVKREDIFYTSKLWCNSHRPEFVRPALERSLKNLQLYYVDLYLIHFPV
SLKPGEELIPKDENGKLLFDTVDLCATWEAMGKCKVAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYLNQRKLLDFCKSKDIVLVAFSALGSHREKPWVDQNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRENMKVFEFQLTSEDMKAIDGLD
RNIRYLTLDIFAGPPNYPFSDEY
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggattcgaaacatcagtgtgtgaagctgaatgatggtcacttcatgcctgtcctggga
tttggcacctatgcgcctgcagaggttcctaaaaataaagctctagaggccaccaaattg
gcaatagaagctgggttccgccatattgattctgctcatttatacaataatgaggagtat
gttggattggccatccgaagcaagattgcagatggcactgtgaagagagaagacatattc
tacacttcaaagctttggtgcaattcccatcgaccagagttcgtccgaccagccttggaa
aggtcactgaaaaatcttcaattatactatgttgacctttatcttattcattttccagtg
tctctaaagccaggtgaggaactgatccccaaagatgaaaatgggaaattactatttgac
acagtggatctctgtgctacgtgggaggccatggggaaatgtaaagttgcaggattggcc
aagtccatcggggtgtccaacttcaaccgcaggcagctggaaatgatcctcaacaagcca
gggctcaagtacaaacctgtctgcaaccaggtggaatgtcatccttacctcaaccagaga
aaactgctggatttctgcaagtccaaagacattgttctggtggcctttagtgctctggga
tcccatcgagaaaaaccatgggtggaccagaactccccggttctcttggaggacccagtc
ctttgtgccttggcaaaaaagcacaagcgaaccccagccctgattgccctgcgctaccag
ctgcagcgtggggttgtggtcctggccaagagctacaatgaacagcggatcagagagaac
atgaaggtctttgaattccagttgacttcagaggacatgaaagccatagatggcctagac
agaaatatacgatatttgacccttgatatttttgctggcccccctaattatccattttct
gatgaatattaa

DBGET integrated database retrieval system