KEGG   Macaca fascicularis (crab-eating macaque): 101866032Help
Entry
101866032         CDS       T02918                                 

Gene name
CPT1B
Definition
(RefSeq) carnitine palmitoyltransferase 1B
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00071  Fatty acid degradation
mcf01212  Fatty acid metabolism
mcf03320  PPAR signaling pathway
mcf04152  AMPK signaling pathway
mcf04714  Thermogenesis
mcf04920  Adipocytokine signaling pathway
mcf04922  Glucagon signaling pathway
mcf04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101866032 (CPT1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101866032 (CPT1B)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101866032 (CPT1B)
   04920 Adipocytokine signaling pathway
    101866032 (CPT1B)
   03320 PPAR signaling pathway
    101866032 (CPT1B)
  09159 Environmental adaptation
   04714 Thermogenesis
    101866032 (CPT1B)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101866032 (CPT1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mcf03029]
    101866032 (CPT1B)
Enzymes [BR:mcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     101866032 (CPT1B)
Mitochondrial biogenesis [BR:mcf03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    101866032 (CPT1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N DUF3128
Motif
Other DBs
NCBI-GeneID: 101866032
NCBI-ProteinID: NP_001270342
UniProt: Q4R7P0
Position
10
AA seq 772 aa AA seqDB search
MAEAHQAVAFQFTVTPEGVDFRLSREALKHVYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVVVMATVGSSFCNVDVSLGLVGCIQRCPPQGCGPYQTPQTRALLSMAIFSTGVWVTG
IFFFRQTLKLLLSYHGWMFEMHGKTSNLTRIWAMCVRLLSSRHPMLYSFQTSLPKLPVPR
VSATIQRYLESVRPLLDDEEYYRMEMLAKEFQNKTAPRLQKYLVLKSWWASNYVSDWWEE
YIYLRGRSPLMVNSNYYVMDLVLIKNTDVQAARLGNIIHAMIMYRRKLDCEEIKPVMALG
IVPMCSYQMERMFNTTRVPGKETDVLQHLSDSRHVAVYHKGRFFKLWLYEGSRLLKPQDL
EMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVA
LDEESYRYDPEDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPI
IGHLWEFVLGTDSFHLGYTETGHCLGKPNPALPPPTRLQWDIPKQCQAVIESSYQVAKAL
ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREG
RTETVRSCTSESTAFVQAMVEKSHAKADLRDLFQKAAKKHQNMYRLAMTGAGIDRHLFCL
YLVSKYLGVSSPFLAEVLSEPWRLSTSQIPQSQIRMFDPEQHPNHLGAGGGFGPVADDGY
GVSYMIAGENTIFFHISSKFSSSETNAQRFGNHIRQALLDLADLFQVPKTDS
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcgcaccaggccgtggccttccagttcacggtgaccccagagggggtcgac
ttccggctcagtcgggaggccctgaaacatgtctacctgtctgggatcaactcctggaag
aaacgcctgatccgcatcaagaatggcatcctcaggggcgtgtaccctggcagccccacc
agctggctggtcgtcgtcatggcaacagtgggttcctccttctgcaacgtggacgtctcc
ttggggctggtcggttgcatccagagatgcccccctcaggggtgtggcccctaccagacc
ccgcagacccgggcacttctcagcatggccatcttctccacgggcgtctgggtgacgggc
atcttcttcttccgccaaaccctgaagctgcttctctcctaccatgggtggatgtttgag
atgcatggcaagaccagcaacttgaccaggatctgggctatgtgtgtccgccttctatcc
agccggcaccccatgctctacagcttccagacatctctgcccaagcttcctgtgcccagg
gtgtcagccacaattcagcggtacctagagtctgtgcgccccttgttggatgatgaggaa
tattaccgcatggagatgctggccaaagaattccagaacaagactgcccccaggctgcag
aaatacctggtgctcaagtcatggtgggcgagtaactatgtgagtgactggtgggaagag
tacatctaccttcgaggcaggagccctctcatggtgaacagcaactactatgtcatggac
cttgtgctcatcaagaatacagacgtgcaggcagcccgcctgggaaacatcatccatgcc
atgatcatgtatcgccgtaaactggactgtgaagaaatcaagcctgtgatggcactaggc
atagtgcccatgtgctcctatcagatggagaggatgttcaacaccactcgggtcccgggc
aaggagacagatgtgctgcagcacctctcagacagccggcacgtggctgtctaccacaag
ggacgcttcttcaagctgtggctctatgagggctcccgtctgctcaagcctcaggatctg
gagatgcagttccagaggatcctggacgacccctccccacctcagcctggggaggagaag
ctggcagccctcactgcaggaggaagggtggagtgggcgcaggcacgccaggccttcttt
agctctggaaagaacaaggctgccttggaggccatcgagcgtgccgctttcttcgtggcc
ctggatgaggagtcctaccgctatgaccccgaagacgaggccagcctcagcctctatggc
aaggccctgctacatggcaactgctacaacaggtggtttgacaaatccttcactcttatt
tccttcaagaatggccagctgggtctcaatgcagagcatgcgtgggcagatgctcccatc
attgggcacctctgggagtttgtcctgggcacagacagcttccacctgggctacacggag
actgggcactgcctgggcaaaccgaaccctgcgctcccacctcctacgcggctgcagtgg
gacattccaaaacagtgccaggcggtcatcgagagttcctaccaggtggccaaggcgctg
gcagacgatgtggagctgtactgcttccagttcctgccctttggcaaaggcctcatcaag
aagtgccggaccagccccgacgcctttgtgcagattgcactgcagctggcgcacttccgg
gacaggggtaagttctgcctgacttatgaggcctcaatgaccagaatgttccgggaggga
cggacggagactgtgcgttcctgtaccagtgagtccacagcctttgtgcaggctatggtg
gagaagtcccacgcgaaagcagacctgcgagatctgttccagaaagctgctaagaagcac
cagaatatgtaccgcctggccatgaccggggcagggatcgacaggcacctcttctgcctt
tacttggtctccaagtacctgggagtcagctctcctttcctcgctgaggtgctctcggaa
ccctggcgtctctccaccagccagatcccccaatcccagatccgcatgtttgacccagag
cagcaccccaatcacctgggtgctggaggtggctttggccctgtagcagatgatggctat
ggagtttcctacatgatcgcgggtgagaacacgatcttcttccacatctccagcaagttc
tcaagctcagagacgaatgcccagcgctttggaaaccacatccgccaagccctgctggac
ctcgctgatcttttccaagtgcccaagaccgacagctga

DBGET integrated database retrieval system