KEGG   Macaca fascicularis (crab-eating macaque): 101866363
Entry
101866363         CDS       T02918                                 

Gene name
RFX5
Definition
(RefSeq) regulatory factor X5
  KO
K08061  regulatory factor X 5
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04612  Antigen processing and presentation
mcf05152  Tuberculosis
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    101866363 (RFX5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101866363 (RFX5)
  09163 Immune disease
   05340 Primary immunodeficiency
    101866363 (RFX5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcf03000]
    101866363 (RFX5)
Transcription factors [BR:mcf03000]
 Eukaryotic type
  Other basic domains
   RF-X
    101866363 (RFX5)
SSDB
Motif
Pfam: RFX5_DNA_bdg RFX5_N RFX_DNA_binding Pox_D5
Other DBs
NCBI-GeneID: 101866363
NCBI-ProteinID: NP_001270944
UniProt: Q4R8Y6
Position
1
AA seq 620 aa
MAEDEPDAKSPKTGGRPPPGGAEAGEPTTLLQRLRGTISKAVQNKVEGILQDVQKFSDND
KLYLYLQLPSGPSTGDKSSEPSTLGNEEYMYAYRWIRNHLEEHTDTCLPKQSVYDAYRKY
CESLACCRPLSTANFGKIIREIFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLPGLDL
KGSESPEMGPEVTPAPRDELVEAACALTCDWAERILKRSFSSIVEVARFLLQQHLISARS
AHAHVLKAMGLAEEDEHAPRERSSKPKNGVENPEGSQAHKKLERPAQPPKDLEARTGAGP
LARGERKKSVVESSAPGANNLQVNALVARLPLLLPRAPRSLIPPIPVSPPILAPRLSSGA
LKVATLPLSSRAGAPSAAVPIINMILPTVPALPGPGPGPGPGPGRAPPGGLTQPRGTENR
EVGIGGDPGPHDKGVKRTAEVPVSEASGQDPPAKAAKQDIEDTASDAKRKRGRPRKKSGG
SGERNSTPQKSAAAMDSAQSRLPWETWGLGGEGNSAGGAERPGPMGEAEKGAVLAQGQED
GTVFKGGRGPSSRHTKEAEDKIPLVPSKVSVIRGSRSQKEAFPLAKGEVGTAPQGNKDLK
EHVLQNSLSQEHKDPKATPP
NT seq 1863 nt   +upstreamnt  +downstreamnt
atggcagaagatgagcctgatgctaagagccccaagactgggggaaggccccctccaggt
ggtgctgaggctggggaacctaccacccttcttcaaaggctccgaggtaccatttccaag
gccgtgcagaacaaagtagagggaatcctgcaagatgtacagaaattttctgacaatgac
aagctgtatctctaccttcagctcccctcaggacccagcactggagacaaaagctcagag
ccaagtacactgggcaatgaggagtacatgtatgcctataggtggatccgcaaccacctg
gaagagcacactgacacctgtctgccaaagcaaagtgtttatgatgcctatcggaagtac
tgtgagagtctcgcctgttgccgcccactcagcacagccaactttggcaagatcatcaga
gagatcttccctgacatcaaagctcgaaggcttggtggccggggccagtccaaatattgc
tacagtggcatacgaaggaagaccttggtgtctatgccacccctgcctggacttgaccta
aagggttctgagagtccagaaatgggcccagaagtaaccccagcacctcgagatgaactg
gtggaggcagcctgtgccctgacgtgtgactgggcagagcggatcctgaaacggtccttc
agttccatcgttgaggtcgcccgcttcctgctacagcagcatctcatctctgcccgatct
gcacatgcccatgtgcttaaggccatggggcttgctgaagaggatgaacatgcacctcgg
gaacggtcatctaaaccaaagaatggtgtagagaacccagagggttcacaagcccataag
aagctggagagaccggcccagcctcctaaggatctggaagcccgaactggggctggccct
ctcgcacgtggagagcggaagaagagtgtagttgagagctcagccccaggagccaataac
ctgcaggttaacgccctagtggctcggctgcctctgctccttccccgggcccctcgctcg
cttattccaccaatcccagtctctccacctattctggcccccaggctttcttcaggtgcc
ctgaaagtggctacactgcctctgtctagtagggccggggcaccctcagcagctgtaccc
atcattaacatgatcttaccaactgttcctgctttgcctggacctggacctgggcctggg
cctgggcctgggcgagctccacctgggggactcactcagccccggggcacagagaacaga
gaggtaggcataggtggtgacccaggaccacatgacaagggtgtcaagaggacagctgaa
gtacctgtgagtgaggccagtgggcaggatccaccagctaaagcagcaaagcaggatata
gaggatacagcaagtgatgccaaaaggaaacgggggcgccctcgaaaaaagtcaggtgga
agtggggaaaggaattctacccctcagaagtcagcagctgccatggactctgcccagtca
aggttaccatgggagacatggggcttaggaggggaaggcaactcagctggaggggcagaa
aggccagggccaatgggagaggctgaaaagggggcagtgcttgcccagggtcaggaagat
ggtactgttttcaaaggaggaaggggccccagttcccggcataccaaagaagcagaagat
aaaattcccttggtcccctcaaaagtgagtgtcatcagaggcagcagaagccaaaaggag
gcttttcctttggcaaagggagaggtaggcactgcaccacagggtaataaagacttaaag
gagcatgtgcttcaaaattccttatcccaggagcataaagaccccaaagcaacaccccca
tga

DBGET integrated database retrieval system