KEGG   Macaca fascicularis (crab-eating macaque): 101866806Help
Entry
101866806         CDS       T02918                                 

Gene name
ERLIN2
Definition
(RefSeq) ER lipid raft associated 2
  KO
K23341  erlin
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcf04121]
    101866806 (ERLIN2)
Ubiquitin system [BR:mcf04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    101866806 (ERLIN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 DUF4346
Motif
Other DBs
NCBI-GeneID: 101866806
NCBI-ProteinID: XP_005563111
Position
8
AA seq 380 aa AA seqDB search
MASSKRRPRRKSRAEGCDGFLARGLGRVRSACRDSLDKGSLMAQLGAVVAVASSFLCASL
FSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNVPCGTS
GGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIE
LFDQIDENLKLALQQDLTSMAPGLVIQAVRVTKPNIPEAIRRNYELMESEKTKLLIAAQK
QKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEKKISEIEDAAFLAREKAKAD
AECYTAMKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKDIPNMFMDSAGSVSKQFEGL
ADKLSFGLEDEPLETATKEN
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcatcgaagcgacggcccagaaggaagtcgcgtgctgaggggtgtgacggtttt
cttgctcgtgggctcggacgagtacggagcgcctgcagggacagcctggataaaggctca
ctgatggctcagttgggagcagttgtggctgtggcttccagtttcttgtgtgcatctctc
ttctcagctgtgcacaagatagaagagggacatattggggtatattacagaggtggtgcc
ctgctgacttcgaccagcggccctggtttccatctcatgctgcctttcatcacatcatat
aagtctgtgcagaccacactccagacagatgaggtgaagaatgtaccttgtgggactagt
ggtggtgtgatgatctactttgacagaattgaagtggtgaacttcctggtcccaaacgca
gtgtatgatatagtgaagaactatactgccgactatgacaaggccctcatcttcaacaag
atccaccacgaactgaaccagttctgcagtgtgcacacacttcaagaggtctacattgag
ctgtttgatcagattgatgaaaatctcaaactggctttgcagcaggacctgacctccatg
gcccctgggctggtcattcaagctgtgcgggtaacaaagcccaacataccagaggcaatc
cgcagaaactacgagttgatggaaagcgagaagacaaagcttcttattgcagcccagaaa
cagaaggtggtggaaaaggaagcagagacagagcggaagaaggcgctcattgaggcagaa
aaagtggcccaggtggctgagatcacctacgggcagaaggtgatggagaaggagactgag
aagaagatttcagaaattgaagatgctgcatttctggcccgggagaaggcaaaggcggat
gctgagtgctacactgctatgaaaatagccgaagccaataagctgaagctaacccctgaa
tatcttcagctgatgaagtacaaggccattgcttccaacagcaagatttactttggcaaa
gacattcctaacatgttcatggactctgcgggcagtgtgagcaagcagtttgaggggcta
gctgacaagctaagctttggcttagaagatgagcccttggagacggccactaaggagaat
tga

DBGET integrated database retrieval system