KEGG   Macaca fascicularis (crab-eating macaque): 101866824
Entry
101866824         CDS       T02918                                 

Gene name
NDUFB5, CI-SGDH
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B5
  KO
K03961  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 5
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00190  Oxidative phosphorylation
mcf01100  Metabolic pathways
mcf04714  Thermogenesis
mcf04723  Retrograde endocannabinoid signaling
mcf04932  Non-alcoholic fatty liver disease
mcf05010  Alzheimer disease
mcf05012  Parkinson disease
mcf05014  Amyotrophic lateral sclerosis
mcf05016  Huntington disease
mcf05020  Prion disease
mcf05022  Pathways of neurodegeneration - multiple diseases
mcf05415  Diabetic cardiomyopathy
Module
mcf_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101866824 (NDUFB5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101866824 (NDUFB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    101866824 (NDUFB5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101866824 (NDUFB5)
   05012 Parkinson disease
    101866824 (NDUFB5)
   05014 Amyotrophic lateral sclerosis
    101866824 (NDUFB5)
   05016 Huntington disease
    101866824 (NDUFB5)
   05020 Prion disease
    101866824 (NDUFB5)
   05022 Pathways of neurodegeneration - multiple diseases
    101866824 (NDUFB5)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101866824 (NDUFB5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101866824 (NDUFB5)
SSDB
Motif
Pfam: NDUF_B5 PanZ Nop14
Other DBs
NCBI-GeneID: 101866824
NCBI-ProteinID: NP_001270530
UniProt: Q4R4E0 G7NZ27
Position
2
AA seq 189 aa
MAGMSLLRRVSVTAVAALSGRSLGTRLGFGGFLTRGFPKAVAPVRHSGGHGKRLFVIKPS
RFYDIRFLKLLRFYIALTGIPVVIIITLVNVFIGEAELAEIPEGYIPEHWEYYKHPISRW
IARNFYDSPEKIYEKSMAVLQIEAEKAELRLKELEVRRLMRMRGDGPWYYYETIDKELID
HSPKATPDN
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcgggcatgagtttgttgcgacgggtttcggttactgcggtggcagcgctttctggc
cgctcccttggcactcgactcggatttgggggcttcctcactcgtggctttccgaaggct
gttgctcctgttcgacacagtggaggccatgggaaaagactatttgtcatcaaaccttct
agattctatgacatccggtttttgaagttattgagattctacattgcattgactgggatt
ccagtagtaattatcataactctggtgaatgtattcattggtgaagctgaactagcagaa
attccagaaggctatatcccagaacactgggaatattataagcatcccatatcgagatgg
attgcccgtaatttctatgacagtcctgaaaagatttatgaaaaatcaatggccgtcctt
cagattgaagctgaaaaggctgaattacggttgaaggagctggaagtacgaagattgatg
cgtatgagaggagatggaccctggtattactatgagacaattgataaggaacttattgat
cattctccaaaagcaactcctgacaattaa

DBGET integrated database retrieval system