KEGG   Macaca fascicularis (crab-eating macaque): 101925362Help
Entry
101925362         CDS       T02918                                 

Gene name
PARP4
Definition
(RefSeq) poly(ADP-ribose) polymerase family member 4
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf03410  Base excision repair
mcf04210  Apoptosis
mcf04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    101925362 (PARP4)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101925362 (PARP4)
   04217 Necroptosis
    101925362 (PARP4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mcf03032]
    101925362 (PARP4)
   03036 Chromosome and associated proteins [BR:mcf03036]
    101925362 (PARP4)
   03400 DNA repair and recombination proteins [BR:mcf03400]
    101925362 (PARP4)
Enzymes [BR:mcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     101925362 (PARP4)
DNA replication proteins [BR:mcf03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     101925362 (PARP4)
Chromosome and associated proteins [BR:mcf03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    101925362 (PARP4)
DNA repair and recombination proteins [BR:mcf03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     101925362 (PARP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP BRCT BRCT_2 PARP_reg PTCB-BRCT LIG3_BRCT DUF3371
Motif
Other DBs
NCBI-GeneID: 101925362
NCBI-ProteinID: XP_015294491
Position
17
AA seq 1227 aa AA seqDB search
MMMMGIFANCIFCLKVKYLPRQQKKKLQTDIKENGGKFSFSLNPQCTHVILDNADVLSQY
QLNSIQKNHVHIANPDFIWESIREKKLLDVKNYDPNKPLDITPPPDQKASGPEVKTEGLC
LDSATEEEDTVELTEFGTENVEIPHLPQDFEVAKYNTLEKVGMEGGQESVVVELQSSRDS
RDCPFLISSHFLLADGMQTRRQFAIKKTSEDASEYYENYIEELKKQGFLLREHFTPEATQ
LASEQLQALLLEEVMTSSTLSQEVSDLVEMIWAEALGHLEHMLLKPVNRISLNDVSKAEG
ILLLVKAALKNGETAEQLQKMMTEFYRLIPHKGTTPKEVNLGLLAKKADLCQLIRDMVNV
CETNLSKPNPPSLAKYRALRCKIEHVEQNTEEFLRVRKEVLQNHHRKSPVDILQIFRVGR
VIETTEFLSKLGNVRPLLHGSPVRNIVGILCRGLLLPKVVEDHGVQRTDVGNLGSGIYFS
DSLRYVRSLITESLLLAVCFLLSLLGEGVSQQNTDLSIIYDLNMPGILFHLQNSYSSTGI
YSYQGCILIEDQMTRLCSPSCHSVSVKWQQLNPDAPEALQAPAQVPSLFRNDRLLVYGFI
PHCTQATLCALIQEKEFCTMVSTTELQKTTGTMIHKLAARALIRDYEDGILHENETSHEM
KKQTLKSLIIKLSKENSLITQFTSFVAVEKRDENESPFPDIPKVSELIAKEDVDFLPYMS
WQGEPQEAVTNQSLLASSEWQEVRSSKRAKRKMKLSQPKVFEDVEEDGLDVLSAFTSSLK
CEGVEKLLDLSQTESCKPTATEPLFRKVSPLETSTSSFFRVCAPAFGSSLPPAARSYSPA
SMPFASHGQGAGFGFAPPPRQLAASLFSQGPVPGSCADWIPQSASHPTGPLQNVPCVPFC
GFPFSEGSLSSTQPAPPPLPGGYTPRPSAGTFPELDSPQPHFSLPTDPDPIRGFGSYHPS
VSSPFHFQPSAASLTANLRVPIAPALPKTLCSQSWTTPVDLCLLEESVDSLEGSQLPGFG
FQSFETESHELSEVLLDSCFLQIKCDTADDSIPCFPEVIEEDEIVCTQHWQDAVPWTELF
SLQTEDGFWKLTPELGLTLNLDTNALHSFLKQKGIQSLGVKGRERLLDLIATMLVLQFIR
TRLEKEGIVFKSLMKLDDASTSRNIPWAFEAIKKASEWVRRTEGQYPSICPRLELGKDWD
SATKQLLGLQPINTVSPLHRVLHYSQG
NT seq 3684 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgatgggaatctttgcaaattgtatcttctgtctgaaagtgaagtacttacct
cggcagcagaagaaaaagctacaaactgacattaaggaaaacggtggaaagttttccttt
tcattaaatcctcagtgcacacatgtaatcttagacaatgctgacgttctgagtcagtac
cagctgaattctatccaaaagaaccacgttcatattgcaaacccagattttatatgggaa
tctatcagagaaaagaaactcttggatgtaaagaattatgatcctaataagcccctggac
atcacaccacctcctgatcagaaggcgagcggtcctgaagtgaaaacagaaggtctgtgc
ctggacagtgccacagaggaggaagacactgtggagctcactgagtttggtacagagaat
gttgaaattcctcatcttcctcaagattttgaagttgcaaaatataacaccttggagaaa
gtgggaatggagggaggccaggaatctgtggttgtggaactgcagagttcgcgggactcc
agggactgtcctttcctgatatcctcacacttcctcctggctgatggcatgcagactaga
agacagtttgctataaagaaaacctctgaagatgcaagtgaatactatgaaaattacatc
gaagaactgaagaaacaaggatttctactaagagaacatttcacacctgaagcaacccag
ttagcatctgaacaattgcaagcattgcttttggaggaagtcatgacttcaagcactctg
agccaagaggtgagcgatttagtagagatgatttgggcagaggcgctgggccacctggaa
cacatgcttctcaagccagtgaacaggattagcctcaacgatgtgagcaaggcagagggg
attctccttctagtaaaggcagcactgaaaaatggagaaacggcagagcaattgcaaaag
atgatgacagagttttacagactgatacctcacaaaggcacaacgcccaaagaagtgaac
ctgggactattggctaagaaagcagacctctgccagctaataagagacatggttaatgtc
tgtgaaacgaatttgtccaaacccaacccaccatccctggccaagtaccgagctttgaga
tgcaaaattgagcatgttgaacagaatactgaagaatttctcagggttagaaaagaggtt
ttgcagaatcatcacaggaagagccctgtggatatcttgcagatatttagagttggcaga
gtgatcgaaaccacagagtttctgagcaaacttggcaatgtgaggcccttgttgcatggt
tctcctgtacgaaacatcgtaggaatcttgtgtcgagggttgcttttacccaaagtagtg
gaagatcatggtgtgcaaagaacagacgtcggaaaccttggaagtgggatttatttcagt
gattcgctcaggtatgttcgatccttaatcacagaatcgttactacttgctgtgtgtttt
cttttgtctctccttggtgagggagtttctcaacaaaacacagatttatctattatatat
gacctcaatatgcctggaatactatttcaccttcaaaatagctattccagtactggaatc
tactcttaccaaggttgcatattaatagaagaccaaatgactaggctatgttctccaagc
tgccactctgtctcggtcaaatggcagcaactcaacccagatgcgcctgaggccctgcag
gccccagcccaggtgccgtccttgtttcgcaatgatcgactccttgtctacggattcatt
cctcactgcacacaggcaactctgtgcgcactaattcaagagaaagaattttgtacaatg
gtgtcgactactgagcttcagaagacaactggaactatgatccacaagctggcagcccga
gctctaatcagagattacgaagatggcattcttcacgaaaatgaaaccagtcatgagatg
aagaaacaaaccttgaaatctctgattattaaactcagtaaagaaaactctctcataaca
caatttacaagctttgtggcagttgagaaaagggatgagaatgagtcgccttttcctgat
attccaaaagtttctgaacttattgccaaagaagatgtagacttcctgccctacatgagc
tggcagggggagccccaagaagccgtcacgaaccagtctcttttagcatcctctgagtgg
caagaagtacgttcatccaaacgggctaaaagaaaaatgaaattatctcagccaaaagtt
tttgaagatgttgaagaggatggcttagatgtactatcagcttttacatcaagtttgaaa
tgtgaaggtgtggaaaagctgttggatttaagtcagacagagtcatgtaaaccaacagca
actgaaccactatttaggaaagtcagtccactggaaacatctacttctagcttttttcgt
gtttgtgctccagcctttggttcctctcttcccccggctgcccgctcttacagtcctgct
tccatgccttttgcctcccatggtcagggagctggttttggttttgctcctcctcccaga
cagttggctgcatctctattcagccaaggccctgtgcctggcagttgtgctgactggatc
ccacagtcggcatctcatcccacagggcctctccagaacgtaccttgtgtacccttctgt
ggctttcctttttcagagggctcattgagctccacacagcctgctccacccccacttcct
ggaggctatacccccaggccttctgctggcaccttccctgagctagattctccccagcct
catttctctcttcctacagatcctgatcccatcagaggttttgggtcttatcatccctct
gtttcctctccttttcattttcaaccttccgcagcctctttgactgccaaccttagggtg
ccaatagcccctgccttacctaagactctttgcagtcagtcctggactaccccagtagat
ctctgtcttctagaagaatcagtagacagtctcgaaggaagtcagttgcctggctttggt
tttcaaagttttgaaacagaaagtcatgaactatcagaagtgcttctagacagctgcttt
ttacaaataaaatgtgatacagcagatgacagtatcccatgctttccggaagtaatagag
gaggatgaaatagtgtgcacacaacactggcaggatgctgtgccttggacagaactcttc
agtctacagacagaggatggcttctggaaacttacaccagaactgggacttacattaaat
cttgatacaaatgctttgcacagctttcttaaacaaaaaggcattcaatctctgggtgta
aaaggaagagaacgtctcctggacctaattgccacaatgctggtactacagtttattcgc
accaggttggaaaaagagggaatagtgttcaaatcactgatgaagctggatgacgcttct
acttccaggaatattccctgggcttttgaggctataaagaaagcaagtgaatgggtaaga
agaactgagggacagtacccatctatctgcccacggcttgaactggggaaagactgggac
tctgccaccaagcagttgctgggactccagcccataaacaccgtgtcccctcttcataga
gtccttcattacagtcaaggctaa

DBGET integrated database retrieval system