KEGG   Macaca fascicularis (crab-eating macaque): 101925579
Entry
101925579         CDS       T02918                                 

Gene name
PARP1
Definition
(RefSeq) poly(ADP-ribose) polymerase 1
  KO
K24070  poly [ADP-ribose] polymerase 1 [EC:2.4.2.30]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf03410  Base excision repair
mcf04064  NF-kappa B signaling pathway
mcf04210  Apoptosis
mcf04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    101925579 (PARP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101925579 (PARP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101925579 (PARP1)
   04217 Necroptosis
    101925579 (PARP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mcf03032]
    101925579 (PARP1)
   03036 Chromosome and associated proteins [BR:mcf03036]
    101925579 (PARP1)
   03400 DNA repair and recombination proteins [BR:mcf03400]
    101925579 (PARP1)
Enzymes [BR:mcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     101925579 (PARP1)
DNA replication proteins [BR:mcf03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     101925579 (PARP1)
Chromosome and associated proteins [BR:mcf03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    101925579 (PARP1)
DNA repair and recombination proteins [BR:mcf03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     101925579 (PARP1)
SSDB
Motif
Pfam: PARP PARP_reg zf-PARP WGR PADR1 BRCT BRCT_2 HGAL ESF1
Other DBs
NCBI-GeneID: 101925579
NCBI-ProteinID: XP_005541069
UniProt: G7NTV2 A0A2K5U0C0
Position
1
AA seq 1014 aa
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV
GHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQAGIGSKAEKTLGDFAAEYAKS
NRSTCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPHCFVKNREELGFRPEYSASQ
LKGFSLLAAEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKA
QNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMAFGALLPCKECSG
QLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPE
TSAPVVATPPPSTASAPAAGNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLT
GTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLHELFLAHILSP
WGAEVKAEPVEVVAPKGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLE
HSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVGTVIGSNK
LEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPG
TKSKLPKPVQDLIKLIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAV
SQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNSADSVQAKVEMLDNLLDIEVAYSLLRG
GSDDSSKDPIDVNYEKLKTDIKVVGRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIE
REGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM
VSKSANYCHTSQGDPIGLIVLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA
SISLDGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW
NT seq 3045 nt   +upstreamnt  +downstreamnt
atggcggagtcttcggataagctctaccgagtcgagtacgccaagagcgggcgcgcctct
tgcaagaaatgcagcgagagcatccccaaggactcgctccggatggccatcatggtgcag
tcgcccatgtttgatggaaaagtcccacactggtaccacttctcctgcttctggaaggtg
ggccattccatccggcaccctgacgtggaggtggatgggttctctgagcttcggtgggat
gaccagcagaaagtcaagaagacagcggaagctggaggagtgacaggcaaaggccaggct
ggaattggtagcaaggcagagaagacactgggtgactttgcagcagagtatgccaagtcc
aacagaagcacatgcaagggatgtatggagaagatagaaaagggccaggtgcgcctgtcc
aagaagatgctggacccggagaagccacagctaggcatgattgaccgctggtaccaccca
cactgctttgtcaagaacagggaggagctgggtttccggcccgagtacagtgcgagtcag
ctcaagggcttcagcctccttgctgcagaggataaagaagccctgaagaagcagctccca
ggagtcaagagcgaaggaaagagaaaaggcgatgaggtggatggagtagatgaagtggcc
aagaagaaatctaaaaaagaaaaagacaaagatagtaagcttgaaaaagctctaaaggct
cagaacgacctgatctggaacatcaaggatgagctaaagaaagtgtgttcgactaatgac
ctgaaggagctactcatcttcaacaagcagcaagtgccttctggggagtcggcgatcttg
gaccgagtagccgatggcatggcgttcggtgccctccttccctgcaaggaatgctcgggt
cagctggtcttcaagagtgatgcttattactgcactggggacgtcactgcctggaccaag
tgtatggtcaagacacagacacccaaccggaaggagtgggtaaccccaaaggaattccga
gaaatctcttacctcaagaaattgaaggttaaaaagcaggaccgtatattccccccagaa
accagcgccccagtggtggccacgcccccaccctccacagcctcggcgcctgctgctggg
aactcctctgcttcagcagataagccattatccaacatgaagatcctgactcttgggaag
ctctcccggaacaaggatgaagtgaaggctatgattgagaaactcggggggaagttgaca
gggacagccaataaggcttccctgtgcatcagcaccaaaaaggaggtggaaaagatgaat
aagaagatggaggaagtaaaggaagccaacatccgagttgtgtctgaggacttcctccag
gacgtctccgcctccaccaagagccttcacgagttgttcttagcacacatcttgtcccct
tggggggcagaggtgaaggcagagcctgtcgaagttgtggccccaaaagggaagtcaggg
gctgcactctccaaaaaaagcaagggccaggtcaaggaggaaggtatcaacaaatctgaa
aagagaatgaaattaactcttaaaggaggagcagctgtggatcctgattctggactggaa
cactctgcgcatgtcctggagaaaggtgggaaggtgttcagtgccaccctcggcctggtg
gacatcgttaaaggaaccaactcctattacaagctgcagcttctggaggacgacaaggaa
agcaggtattggatattcaggtcctggggccgtgtggggacggtgatcggtagcaacaaa
ctggaacagatgccgtccaaggaggatgccattgagcacttcatgaaattatatgaagaa
aaaaccgggaacgcttggcactccaaaaatttcacaaagtatcccaaaaagttctacccc
ctggagattgactacggccaggatgaagaggcagtgaagaagctgacagtaaatcctggc
accaagtccaagctccccaagccagttcaggacctcatcaagctgatctttgatgtggaa
agtatgaagaaagccatggtggaatatgagatcgaccttcagaagatgcccttggggaag
ctgagcaaaaggcagatccaggccgcgtactccatcctcagtgaggtacagcaggcagtg
tctcagggcagcagcgactctcagatcctggatctctcaaatcgcttttacaccctgatc
ccccatgactttgggatgaagaagcctccgctcctgaacagtgcagacagtgtgcaggcc
aaggtggaaatgcttgacaacctgctggacatcgaggtggcctacagtctgctcagggga
gggtctgatgatagcagcaaggaccccatcgatgtcaactatgagaagctcaaaactgac
attaaggtggttggcagagattctgaagaagccgagatcatcaggaagtatgttaagaac
actcatgcaaccacacacaatgcgtatgacttggaagtcatcgatatctttaagatagag
cgtgaaggcgaatgccagcgctacaagccctttaagcagcttcataaccgaagattgctg
tggcacgggtccaggaccaccaactttgccgggatcctgtcccagggtcttcggatagcc
ccgcctgaagcacctgtgacaggctacatgtttggtaaagggatctatttcgctgacatg
gtctccaagagtgccaactactgccatacgtctcagggagacccaataggcttaatcgtg
ttgggagaagttgcccttggaaacatgtatgaactgaagcacgcttcacatatcagcaag
ttacccaaggggaagcacagtgtcaaaggtttgggcaaaactacccctgacccttcagct
agtattagtctggatggtgtagaggttcctcttgggaccgggatttcatctggtgtgaat
gacacctgtctactatataacgagtacattgtctacgatattgctcaggtaaatctgaag
tatctgctgaaactgaaattcaattttaagacctccctgtggtaa

DBGET integrated database retrieval system