KEGG   Macaca fascicularis (crab-eating macaque): 101925611
Entry
101925611         CDS       T02918                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00230  Purine metabolism
mcf00240  Pyrimidine metabolism
mcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101925611 (DCK)
   00240 Pyrimidine metabolism
    101925611 (DCK)
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     101925611 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_33 AAA_28 DUF932 CoaE
Other DBs
NCBI-GeneID: 101925611
NCBI-ProteinID: NP_001272173
UniProt: Q4R5R5
Position
5
AA seq 260 aa
MATPPKRSCPSLSASSEGTRIKKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPVARWCN
VQSTQDEFEELTTSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAE
KPVLLFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLRA
TPEKCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTDFDYLQEVPILIPDVNE
DFKDKHESLVEKVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaccccgcccaagagaagctgcccgtctctctcagccagctctgaggggacccgc
atcaagaaaatctccatcgaagggaacatcgctgcagggaagtcaacatttgtgaatatc
cttaaacaagtgtgtgaagattgggaagtggttcctgaacctgttgccagatggtgcaat
gttcaaagtactcaagatgaatttgaggaacttacaacgtctcagaaaaatggtgggaat
gttcttcagatgatgtatgagaaacctgaacgatggtcttttaccttccaaacatatgcc
tgtctcagtcgaataagagctcagcttgcctctctcaatggcaagctcaaagatgcagag
aaacctgtattactttttgaacgatctgtgtatagtgacaggtatatttttgcatctaat
ttgtatgaatctgaatgcatgaatgaaactgagtggacaatttatcaagactggcatgac
tggatgaataaccaatttggccaaagccttgaattggatggaatcatttatcttcgagcc
actccagagaaatgcttacatcgaatatatttacggggaagaaatgaagagcaaggcatt
cctcttgaatatttagagaagcttcattataaacatgaaagctggctcctgcataggaca
ctgaaaaccgacttcgattatcttcaagaggtgcctatcttaataccggatgttaatgaa
gactttaaagacaaacatgaaagtctggttgaaaaggtcaaagaatttttgagtactttg
tga

DBGET integrated database retrieval system