KEGG   Macaca fascicularis (crab-eating macaque): 101926183Help
Entry
101926183         CDS       T02918                                 

Gene name
CPT1A
Definition
(RefSeq) carnitine palmitoyltransferase 1A
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00071  Fatty acid degradation
mcf01212  Fatty acid metabolism
mcf03320  PPAR signaling pathway
mcf04152  AMPK signaling pathway
mcf04714  Thermogenesis
mcf04920  Adipocytokine signaling pathway
mcf04922  Glucagon signaling pathway
mcf04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101926183 (CPT1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101926183 (CPT1A)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101926183 (CPT1A)
   04920 Adipocytokine signaling pathway
    101926183 (CPT1A)
   03320 PPAR signaling pathway
    101926183 (CPT1A)
  09159 Environmental adaptation
   04714 Thermogenesis
    101926183 (CPT1A)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101926183 (CPT1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mcf03029]
    101926183 (CPT1A)
Enzymes [BR:mcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     101926183 (CPT1A)
Mitochondrial biogenesis [BR:mcf03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    101926183 (CPT1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 101926183
NCBI-ProteinID: XP_015289825
UniProt: A0A2K5UZT4
Position
14
AA seq 773 aa AA seqDB search
MAEAHQAVAFQFTVTPDGIDLRLSHEALRQIYLSGLHSWKKKFIRFKNGIITGVYPASPS
SWLIVVVGVMTTMYAKIDPSLGIIAKINRTLETTDCMSSQMKNVVSGVLFGTGLWVALIV
TMRYSLKVLLSYHGWMFTEHGKMSRATKIWMGMVKIFSGRKPMLYSFQTSLPRLPVPAVK
DTVNRYLESVRPLMKEEDFKRMTALAQDFAVSLGPRLQWYLKLKSWWATNYVSDWWEEYI
YLRGRGPLMVNSNYYAMDLLYVLPTHIQAARAGNTVHAILLYRRKLDREEIKPIRLLGST
IPLCSAQWERMFNTSRIPGEETDTIQHMRDSKHIVVYHRGRYFKVWLYHDGRLLKPREME
QQMQRILDNTSEPQPGEARLAALTAGDRVPWARCRQAYFGRGKNKQSLDAVEKAAFFVTL
DETEQGYRTEDPDTSMDSYAKSLLHGQCYDRWFDKSFTFVVFKNGKIGINAEHSWADAPI
MAHLWEYVMSTDSLQLGYAEDGHCKGDTNPNIPYPTRLQWDIPGECQEVIETSLNTANLL
ANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREG
RTETVRSCTAESCDFVQAMVDPAQTVEQRLKLFKVASEKHQHMYRLAMTGSGIDRHLFCL
YVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGY
GVSYILVGENLINFHISSKFSCPETDSHRFGKHLKEAMFDIITLFGLSSNSKK
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagctcaccaagctgtagcttttcagttcacggtcactccggatgggatcgac
ctgcggctgagccatgaagctcttagacaaatctatctctctggacttcattcctggaag
aagaagttcatccgattcaagaatggcatcatcactggcgtgtacccggcgagcccctcc
agttggcttatcgtggtggtgggtgtgatgacaacaatgtatgccaagattgacccctcg
ttaggaataattgcaaaaatcaatcggaccctggaaacaactgactgcatgtccagccag
atgaagaacgtggtcagcggcgtgctgtttggcaccgggctgtgggtggccctcatcgtc
accatgcgctactccctgaaggtgctgctgtcctaccacgggtggatgttcactgagcac
ggcaagatgagtcgcgccaccaagatctggatgggtatggtcaagatcttttcaggccga
aaacccatgttgtacagcttccagacatcgctccctcgcctgccggtcccggctgtcaaa
gacactgtgaacaggtatctagagtcggtgaggcctcttatgaaggaagaagacttcaaa
cggatgacggcacttgctcaagactttgctgtcagtcttggaccaagactacagtggtat
ttgaagttaaaatcctggtgggctacaaattacgtgagcgactggtgggaggagtacatc
tacctccgaggacgagggccactcatggtgaacagcaactactatgccatggatctgctg
tatgtccttccaactcacattcaggcagcaagagccggcaacaccgtccacgccatcctg
ctttacaggcgcaaactggaccgggaggaaatcaaaccaattcgtcttttgggatccacg
attccactctgctccgctcagtgggagcgaatgtttaacacttcccggatcccaggagag
gagacagacaccatccagcacatgagagacagcaagcacatcgtcgtgtaccatcgaggg
cgctacttcaaggtctggctctaccacgacgggcggctgctgaagccccgggagatggag
cagcagatgcagaggatcctggacaacacctcggagcctcagcctggggaggccaggctg
gcagccctcaccgcaggagacagagttccctgggccaggtgtcgccaggcctattttgga
cgggggaaaaataaacagtctcttgatgccgtggagaaggcagcgttcttcgtgacgtta
gatgaaactgaacaaggatacagaacggaagacccagatacatcgatggacagctacgcc
aagtctctactacatggccaatgttatgacaggtggtttgacaagtcgttcacgtttgtt
gtcttcaaaaacgggaagataggcatcaacgcggagcactcctgggcagacgcgccgatc
atggcccacctttgggagtacgtcatgtccactgacagcctccagttgggctatgcagag
gatgggcactgcaaaggcgacaccaatccgaacattccgtaccccaccaggctgcagtgg
gacatccccggggaatgtcaagaggttatagagacctccctgaacaccgcaaatcttctg
gcaaacgacgtggatttccattccttcccattcgttgcctttggtaaaggaatcatcaag
aaatgtcgcacgagcccagacgcctttgtgcagctggccctccagctggcgcactacaag
gatatgggcaagttttgcctcacatacgaggcctccatgacccggctcttccgagagggg
agaacggagaccgtgcgctcctgcaccgctgagtcgtgcgacttcgtgcaggccatggtg
gacccggcccagacggtggaacagaggctgaaattgttcaaggtggcgtctgagaagcat
cagcatatgtatcgcctcgccatgaccggctccgggatcgatcgtcacctcttctgcctt
tatgtggtgtctaaatatctcgctgtggagtcccctttccttaaggaagttttatctgag
ccttggagattatcaacaagccagacacctcagcagcaagtggagctgtttgacctggag
aataacccagaatacgtgtccagcggagggggctttggaccggttgctgacgatggctat
ggtgtgtcatacatccttgtgggagagaacctcatcaatttccacatttcttccaagttc
tcttgccctgagacggattctcatcgctttggaaagcacctgaaagaagcaatgtttgac
atcatcactttgtttggtctcagttctaattccaaaaagtaa

DBGET integrated database retrieval system